EY659499

Overview
NameEY659499
Unique NameEY659499
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length922
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7556 contig Csv1_Contig7556:60..983. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659499 vs. ExPASy Swiss-Prot
Match: DJC10_MOUSE (DnaJ homolog subfamily C member 10 OS=Mus musculus GN=Dnajc10 PE=1 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 2.729e-24
Identity = 62/201 (30.85%), Postives = 104/201 (51.74%), Query Frame = 1
Query:   79 VVVLTEDNFEKEVGQ---DRGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNEGGTNVKIAAVPSNVVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFF 672
            VV LT   F + V Q   D   +V+FY+PWC  C+ L PE++++  +      + +G VDC ++ S C++  VQ YP I+++P+ S +  +Y         A  + + G     +  +P   + LT   F+E VL      +V+FYAPWCG C+N AP +E +A    ++  V    +D   Y    +K G+  +P++K +
Sbjct:  558 VVSLTPSTFNELVKQRKHDEVWMVDFYSPWCHPCQVLMPEWKRMARTLTGL--INVGSVDCQQYHSFCTQENVQRYPEIRFYPQKSSKAYQYHSYNGWNRDAYSLRSWG-----LGFLPQASIDLTPQTFNEKVLQGKTHWVVDFYAPWCGPCQNFAPEFELLAR--MIKGKVRAGKVDCQAYPQTCQKAGIKAYPSVKLY 749          

HSP 2 Score: 108.227 bits (269), Expect = 6.722e-23
Identity = 60/191 (31.41%), Postives = 99/191 (51.83%), Query Frame = 1
Query:  136 LVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNEGGTNVKIAAVPSNVVVLTADNFDEIVLDKSKDV--LVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGHKDGEEY 702
            LV+F+APWC  C+ L PE  K  AS      + +G +DC  H+ LC+ Y +Q YPT   F + S+   +YEG  S E + E++ +             +VV LT   F+E+V  +  D   +V+FY+PWC  C+ L P ++++A    L   + V ++D  +Y     +  V  +P ++F+P+      +Y
Sbjct:  472 LVDFFAPWCPPCRALLPELRK--ASTLLYGQLKVGTLDCTIHEGLCNMYNIQAYPTTVVFNQSSIH--EYEGHHSAEQILEFIEDLRN---------PSVVSLTPSTFNELVKQRKHDEVWMVDFYSPWCHPCQVLMPEWKRMAR--TLTGLINVGSVDCQQYHSFCTQENVQRYPEIRFYPQKSSKAYQY 647          
BLAST of EY659499 vs. ExPASy Swiss-Prot
Match: PDIA3_MOUSE (Protein disulfide-isomerase A3 OS=Mus musculus GN=Pdia3 PE=1 SV=2)

HSP 1 Score: 112.464 bits (280), Expect = 3.564e-24
Identity = 59/147 (40.14%), Postives = 84/147 (57.14%), Query Frame = 1
Query:   64 ALADDVVVLTEDNFEKEVGQDRGA---LVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNEGGTNVKIAAVPSNVVVLTADNFDEIVLDKSKDVL 495
            A A DV+ LT++NFE  V     A   LVEF+APWCGHCK+LAPEYE      K    V + KVDC  + + C+KYGV GYPT++ F  G  E   Y+GPR+ + +  ++  + G        P++V + T + F + + DK   V+
Sbjct:   22 AAASDVLELTDENFESRVSDTGSAGLMLVEFFAPWCGHCKRLAPEYEAAATRLKGI--VPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGE-EAGAYDGPRTADGIVSHLKKQAG--------PASVPLRTEEEFKKFISDKDASVV 157          

HSP 2 Score: 108.997 bits (271), Expect = 3.941e-23
Identity = 55/140 (39.29%), Postives = 84/140 (60.00%), Query Frame = 1
Query:  346 EGPRSTEALAEYVNNEGGTNVKIAAVPSN----VVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGHK-DGEEYGGGRYLEDFVSFINEK 750
            +G    + L EY +      +K   +P +    V V+ A+NFD+IV ++ KDVL+EFYAPWCGHCKNL P Y+++    + + ++V+A +DA    D+   Y V GFPT+ F P   K   ++Y GGR L DF+S++  +
Sbjct:  345 DGKALEQFLQEYFDGNLKRYLKSEPIPESNEGPVKVVVAENFDDIVNEEDKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATA-NDVPSPYEVKGFPTIYFSPANKKLTPKKYEGGRELNDFISYLQRE 483          

HSP 3 Score: 90.8929 bits (224), Expect = 1.111e-17
Identity = 52/115 (45.22%), Postives = 68/115 (59.13%), Query Frame = 1
Query:  418 AVPSNVVVLTADNFDEIVLDKSKD--VLVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGHKDGEEYGGGRYLEDFVSFINEKCG 756
            A  S+V+ LT +NF+  V D      +LVEF+APWCGHCK LAP YE  AAA  L+  V +A +D     +   KYGVSG+PTLK F  G + G  Y G R  +  VS + ++ G
Sbjct:   22 AAASDVLELTDENFESRVSDTGSAGLMLVEFFAPWCGHCKRLAPEYE--AAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAG-AYDGPRTADGIVSHLKKQAG 133          

HSP 4 Score: 89.3521 bits (220), Expect = 3.231e-17
Identity = 45/107 (42.06%), Postives = 64/107 (59.81%), Query Frame = 1
Query:   79 VVVLTEDNFEKEVGQ-DRGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKG-SLEPKKYEGPRSTEALAEYVNNE 393
            V V+  +NF+  V + D+  L+EFYAPWCGHCK L P+Y++LG    K  +++I K+D   +  + S Y V+G+PTI + P    L PKKYEG R       Y+  E
Sbjct:  378 VKVVVAENFDDIVNEEDKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATAN-DVPSPYEVKGFPTIYFSPANKKLTPKKYEGGRELNDFISYLQRE 483          
BLAST of EY659499 vs. ExPASy Swiss-Prot
Match: DJC10_PONAB (DnaJ homolog subfamily C member 10 OS=Pongo abelii GN=DNAJC10 PE=2 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 3.564e-24
Identity = 65/226 (28.76%), Postives = 109/226 (48.23%), Query Frame = 1
Query:    4 DIERYQIWLALSTLTLFFVSALADDVVVLTEDNFEKEVGQDRGA---LVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNEGGTNVKIAAVPSNVVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFF 672
            +I  Y+   +   +  F    +   VV LT   F + V Q +     +V+FY+PWC  C+ L PE++++  +      + +G +DC ++ S C++  VQ YP I++FP  S +  +Y         A  +   G     +  +P     LT   F E VL      +++FYAPWCG C+N AP +E +A    ++  V    +D   Y    +K G+  +PT+KF+
Sbjct:  533 NIHEYEGHHSAEQILEFIEDLMNPSVVSLTPTTFNELVTQRKHNEVWMVDFYSPWCHPCQVLMPEWKRMARTLTGL--INVGSIDCQQYHSFCAQENVQRYPEIRFFPPKSNKAYQYHSYNGWNRDAYSLRIWG-----LGFLPQVSTGLTPQTFSEKVLQGKNHWVIDFYAPWCGPCQNFAPEFELLAR--MIKGKVKAGKVDCQAYAQTCQKAGIRAYPTVKFY 749          

HSP 2 Score: 104.76 bits (260), Expect = 7.432e-22
Identity = 58/191 (30.37%), Postives = 98/191 (51.31%), Query Frame = 1
Query:  136 LVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNEGGTNVKIAAVPSNVVVLTADNFDEIVLDKSKDV--LVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGHKDGEEY 702
            LV+F+APWC  C+ L PE  +  AS      +  G +DC  H+ LC+ Y +Q YPT   F + ++   +YEG  S E + E++ +          +  +VV LT   F+E+V  +  +   +V+FY+PWC  C+ L P ++++A    L   + V ++D  +Y     +  V  +P ++FFP       +Y
Sbjct:  472 LVDFFAPWCPPCRALLPELRR--ASNLLYGQLKFGTLDCTVHEGLCNMYNIQAYPTTVVFNQSNIH--EYEGHHSAEQILEFIED---------LMNPSVVSLTPTTFNELVTQRKHNEVWMVDFYSPWCHPCQVLMPEWKRMAR--TLTGLINVGSIDCQQYHSFCAQENVQRYPEIRFFPPKSNKAYQY 647          
BLAST of EY659499 vs. ExPASy Swiss-Prot
Match: DJC10_HUMAN (DnaJ homolog subfamily C member 10 OS=Homo sapiens GN=DNAJC10 PE=1 SV=2)

HSP 1 Score: 112.079 bits (279), Expect = 4.655e-24
Identity = 73/261 (27.97%), Postives = 120/261 (45.98%), Query Frame = 1
Query:    4 DIERYQIWLALSTLTLFFVSALADDVVVLTEDNFEKEVGQDRGA---LVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNEGGTNVKIAAVPSNVVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFF---PKGHKDGEEYGGGRYLEDFVSFINEKCGTSRD 768
            +I  Y+   +   +  F    +   VV LT   F + V Q +     +V+FY+PWC  C+ L PE++++  +      + +G +DC ++ S C++  VQ YP I++FP  S +   Y         A  +   G     +  +P     LT   F E VL      +++FYAPWCG C+N AP +E +A    ++  V    +D   Y    +K G+  +PT+KF+          EE    R  +   + I+EK  T R+
Sbjct:  533 NIHEYEGHHSAEQILEFIEDLMNPSVVSLTPTTFNELVTQRKHNEVWMVDFYSPWCHPCQVLMPEWKRMARTLTGL--INVGSIDCQQYHSFCAQENVQRYPEIRFFPPKSNKAYHYHSYNGWNRDAYSLRIWG-----LGFLPQVSTDLTPQTFSEKVLQGKNHWVIDFYAPWCGPCQNFAPEFELLAR--MIKGKVKAGKVDCQAYAQTCQKAGIRAYPTVKFYFYERAKRNFQEEQINTRDAKAIAALISEKLETLRN 784          

HSP 2 Score: 103.99 bits (258), Expect = 1.268e-21
Identity = 57/182 (31.32%), Postives = 96/182 (52.75%), Query Frame = 1
Query:  136 LVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNEGGTNVKIAAVPSNVVVLTADNFDEIVLDKSKDV--LVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFFP 675
            LV+F+APWC  C+ L PE  +  AS      +  G +DC  H+ LC+ Y +Q YPT   F + ++   +YEG  S E + E++ +          +  +VV LT   F+E+V  +  +   +V+FY+PWC  C+ L P ++++A    L   + V ++D  +Y     +  V  +P ++FFP
Sbjct:  472 LVDFFAPWCPPCRALLPELRR--ASNLLYGQLKFGTLDCTVHEGLCNMYNIQAYPTTVVFNQSNIH--EYEGHHSAEQILEFIED---------LMNPSVVSLTPTTFNELVTQRKHNEVWMVDFYSPWCHPCQVLMPEWKRMAR--TLTGLINVGSIDCQQYHSFCAQENVQRYPEIRFFP 638          
BLAST of EY659499 vs. ExPASy Swiss-Prot
Match: DJC10_RAT (DnaJ homolog subfamily C member 10 OS=Rattus norvegicus GN=Dnajc10 PE=2 SV=2)

HSP 1 Score: 111.694 bits (278), Expect = 6.080e-24
Identity = 61/201 (30.35%), Postives = 103/201 (51.24%), Query Frame = 1
Query:   79 VVVLTEDNFEKEVGQ---DRGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNEGGTNVKIAAVPSNVVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFF 672
            VV LT   F + V Q   D   +V+FY+PWC  C+ L PE++++  +      + +G VDC ++ S C++  VQ YP I+++P+ S    +Y         A  + + G     +  +P   + LT   F+E VL      +++FYAPWCG C+N AP +E +A    ++  V    +D   Y    +K G+  +P++K +
Sbjct:  558 VVSLTPTTFNELVKQRKHDEVWMVDFYSPWCHPCQVLMPEWKRMARTLTGL--INVGSVDCQQYHSFCTQENVQRYPEIRFYPQKSSRAYQYHSYNGWNRDAYSLRSWG-----LGFLPQASIDLTPQTFNEKVLQGKTHWVIDFYAPWCGPCQNFAPEFELLAR--MIKGKVKAGKVDCQAYPQTCQKAGIRAYPSVKLY 749          

HSP 2 Score: 107.071 bits (266), Expect = 1.498e-22
Identity = 60/191 (31.41%), Postives = 99/191 (51.83%), Query Frame = 1
Query:  136 LVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNEGGTNVKIAAVPSNVVVLTADNFDEIVLDKSKDV--LVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGHKDGEEY 702
            LV+F+APWC  C+ L PE  K  AS      + +G +DC  H+ LC+ Y +Q YPT   F + S+   +YEG  S E + E++ +             +VV LT   F+E+V  +  D   +V+FY+PWC  C+ L P ++++A    L   + V ++D  +Y     +  V  +P ++F+P+      +Y
Sbjct:  472 LVDFFAPWCPPCRALLPELRK--ASTLLYGQLKVGTLDCTIHEGLCNMYNIQAYPTTVVFNQSSVH--EYEGHHSAEQILEFIEDLRN---------PSVVSLTPTTFNELVKQRKHDEVWMVDFYSPWCHPCQVLMPEWKRMAR--TLTGLINVGSVDCQQYHSFCTQENVQRYPEIRFYPQKSSRAYQY 647          
BLAST of EY659499 vs. ExPASy Swiss-Prot
Match: ERP60_SCHMA (Probable protein disulfide-isomerase ER-60 OS=Schistosoma mansoni PE=3 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 1.037e-23
Identity = 76/222 (34.23%), Postives = 110/222 (49.55%), Query Frame = 1
Query:   49 LFFVS-ALADDVVVLTEDNFEKEVGQDRGALVEFYAPWCGHCKKLAPEYEKLGASFK-KAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNEGGTNVKIAAVPSNVVVLTADNFDEI--VLDKSKDVLVEFY----------APWCGHCKNLAPT--------YEKVAAAFALEDDVVV--ANLDADKYKDLAEKYG 642
            LF V+ A    V+ LT+DNF  E+     ALV+FYAPWCGHCKKLAPE+         K   V + KVDC   +S+CS++GV GYPT++ F  G L+  +Y GPR+   +A Y+ +  G   K  +  S+V  + +D+   +   +  S D L++ +          A +C    NL  T        Y         EDD  V    L+++  KD   K+G
Sbjct:    8 LFLVAFASCSKVLELTKDNFHSELKSIPVALVKFYAPWCGHCKKLAPEFTSAAQIISGKTNDVKLVKVDCTTQESICSEFGVSGYPTLKIFRNGDLD-GEYNGPRNANGIANYMISRAGPVSKEVSTVSDVENVLSDDKPTVFAFVKSSSDPLIKTFMALAKSMVDDAVFCHSHNNLFVTPSDNELRVYLPKRLRTKFEDDFAVYKGELESNNIKDWIRKHG 228          

HSP 2 Score: 98.9821 bits (245), Expect = 4.078e-20
Identity = 72/203 (35.47%), Postives = 106/203 (52.22%), Query Frame = 1
Query:  214 KKAKSVLIGKVDCDEHKSLCSKYGVQG--YPTIQWFPKGSLEPKKYEGPR-STEALAEYVNN-EGGT---NVKIAAVPSN----VVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGHKDGE-EYGGGRYLEDFVSFI-----NEKCGTSRDG 771
            +K K+++      D+     S YG++    P +    K     KKY+  + S +A ++++N  E G    +VK   +P++    V  L A NFDEIV ++ KDV+V F+A WCGHCKNL P YE+ A+    E ++V+A +DA    D+   Y V GFPT+ F PKG K     Y GGR   D + ++      E  G  R G
Sbjct:  280 QKFKNLVFAYSFADDFSYEISDYGIEADKLPAVVIQSKD----KKYKLEKFSLDAFSDFLNKFEDGLLTPHVKSEPLPTDDSSAVKKLVALNFDEIVNNEEKDVMVVFHAGWCGHCKNLMPKYEEAASKVKNEPNLVLAAMDATA-NDVPSPYQVRGFPTIYFVPKGKKSSPVSYEGGRDTNDIIKYLAREATEELIGYDRSG 477          

HSP 3 Score: 81.2629 bits (199), Expect = 8.800e-15
Identity = 44/111 (39.64%), Postives = 61/111 (54.95%), Query Frame = 1
Query:  427 SNVVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAFALE-DDVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGHKDGEEYGGGRYLEDFVSFINEKCG 756
            S V+ LT DNF    L      LV+FYAPWCGHCK LAP +   A   + + +DV +  +D    + +  ++GVSG+PTLK F  G  DG EY G R      +++  + G
Sbjct:   17 SKVLELTKDNFHS-ELKSIPVALVKFYAPWCGHCKKLAPEFTSAAQIISGKTNDVKLVKVDCTTQESICSEFGVSGYPTLKIFRNGDLDG-EYNGPRNANGIANYMISRAG 125          

HSP 4 Score: 72.4034 bits (176), Expect = 4.088e-12
Identity = 36/100 (36.00%), Postives = 59/100 (59.00%), Query Frame = 1
Query:  100 NFEKEVG-QDRGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKG-SLEPKKYEGPRSTEALAEYVNNE 393
            NF++ V  +++  +V F+A WCGHCK L P+YE+  +  K   ++++  +D   +  + S Y V+G+PTI + PKG    P  YEG R T  + +Y+  E
Sbjct:  367 NFDEIVNNEEKDVMVVFHAGWCGHCKNLMPKYEEAASKVKNEPNLVLAAMDATAN-DVPSPYQVRGFPTIYFVPKGKKSSPVSYEGGRDTNDIIKYLARE 465          
BLAST of EY659499 vs. ExPASy Swiss-Prot
Match: DJC10_XENLA (DnaJ homolog subfamily C member 10 OS=Xenopus laevis GN=dnajc10 PE=2 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 1.037e-23
Identity = 63/218 (28.90%), Postives = 113/218 (51.83%), Query Frame = 1
Query:   79 VVVLTEDNFEKEVGQDRGA---LVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPK----KYEG-PRSTEALAEYVNNEGGTNVKIAAVPSNVVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGHKDGEEYGG 708
            VV LT + F+  V   RG    +V+FYAPWCG C+ L PE++++        SV  G +DC ++   C++  V GYP I+ +P  ++ P+    +Y G  R +++L  +          +  +P     LT ++F E V++   + +++FYAPWCG C+N  P +E +A   A++  +    ++   Y+ L     +  +PT++ +P      ++Y G
Sbjct:  559 VVTLTPETFQSLVRNRRGDEMWMVDFYAPWCGPCQALMPEWKRMARHINGLISV--GSIDCQKYSLFCTQERVNGYPEIRLYP-ANINPQHTYYRYTGWHRDSQSLRNWA---------LMYLPKASFDLTPESFHEHVINGKDNWVLDFYAPWCGPCQNFNPEFEILAR--AVKGKIKAGKVNCQAYEHLCNSASIRSYPTVRLYPYNGSKKKDYFG 762          

HSP 2 Score: 104.375 bits (259), Expect = 9.707e-22
Identity = 64/217 (29.49%), Postives = 109/217 (50.23%), Query Frame = 1
Query:   34 LSTLTLFFVSALADDVVVLTEDNFEKEVGQDRGA-LVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNEGGTNVKIAAVPSNVVVLTADNFDEIVLDKSKDV--LVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFFP 675
            L  L  F   ++   V+ L   NF    G+DR   LV+F+APWC  C+ L PE     AS +    +  G +DC  H+ LC+ + ++ YPT   F   ++   +Y G  + E + E++ +             +VV LT + F  +V ++  D   +V+FYAPWCG C+ L P ++++A    +   + V ++D  KY     +  V+G+P ++ +P
Sbjct:  441 LYDLVSFAKESVNSHVITLGPTNFP---GKDRDTWLVDFFAPWCPPCRALLPELRI--ASKRLFGQIKFGTLDCTIHEGLCNMHNIRAYPTTVVFNHSNIH--EYAGHNNAEEILEFIEDLRN---------PSVVTLTPETFQSLVRNRRGDEMWMVDFYAPWCGPCQALMPEWKRMAR--HINGLISVGSIDCQKYSLFCTQERVNGYPEIRLYP 639          

HSP 3 Score: 75.0998 bits (183), Expect = 6.306e-13
Identity = 68/222 (30.63%), Postives = 100/222 (45.05%), Query Frame = 1
Query:   73 DDVVVLTEDNFEKEVGQDRGAL--VEFYAPWCGHCKKLAPEYEKLGASFKKAKSVL-IGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNEGGTNVKIAAVPSNVVVLTADNFDEIVLDK-SKDV--LVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGHKDGEEYGGGRYL 720
            DD+ ++T D  E +   + G L  + FY+P C HC  LAP + +     K+   +L IG V+C +++ LC   G+  YP +  F K  + P KY G RS E L          N  +  + S V  L A NF   + D  S  V  L+ F +   G C N + T  K+A    LE  V V  +D     DL +   ++   T+ F P      +E G   +L
Sbjct:  128 DDLEIITLDRGEFDGAVNSGELWFINFYSPGCSHCHDLAPTWRQFA---KEMDGLLRIGAVNCGDNRMLCRSQGINSYPNLYIF-KSGMNPVKYYGERSKERL---------VNFAMPYISSTVTELWAGNFRSSIEDAFSSGVGWLITFCSD-TGDCLN-SQTRSKLAG--LLEGLVKVGWMDCATQGDLCDNLEITSSATVYFPPGSTLTDKENGDVLFL 332          
BLAST of EY659499 vs. ExPASy Swiss-Prot
Match: PDI_WHEAT (Protein disulfide-isomerase OS=Triticum aestivum GN=PDI PE=2 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 1.769e-23
Identity = 60/125 (48.00%), Postives = 77/125 (61.60%), Query Frame = 1
Query:  391 EGGTNVKIAAVPSNVVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAFALEDD-VVVANLDA--DKYKDLAEKYGVSGFPTLKFFPKGHKDGEEYGGGRYLEDFVSFINEKCG 756
            E     + AA P  V+ L ADNFD+ +  K   +LVEFYAPWCGHCK+LAP YEK A   +  D  +V+A +DA  +K K LA KY V GFPTLK F  G K+ +EY G R  E  V ++ ++ G
Sbjct:   27 EAAAAEEAAAAPEAVLTLHADNFDDAIA-KHPFILVEFYAPWCGHCKSLAPEYEKAAQLLSKHDPAIVLAKVDANDEKNKPLAGKYEVQGFPTLKIFRSGGKNIQEYKGPREAEGIVEYLKKQVG 150          

HSP 2 Score: 103.99 bits (258), Expect = 1.268e-21
Identity = 52/131 (39.69%), Postives = 75/131 (57.25%), Query Frame = 1
Query:   61 SALADDVVVLTEDNFEKEVGQDRGALVEFYAPWCGHCKKLAPEYEKLGASFKK-AKSVLIGKVDCDEHKS--LCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNEGGTNVKIAAVPSNVVVL 444
            +A  + V+ L  DNF+  + +    LVEFYAPWCGHCK LAPEYEK      K   ++++ KVD ++ K+  L  KY VQG+PT++ F  G    ++Y+GPR  E + EY+  + G   K    P +   L
Sbjct:   35 AAAPEAVLTLHADNFDDAIAKHPFILVEFYAPWCGHCKSLAPEYEKAAQLLSKHDPAIVLAKVDANDEKNKPLAGKYEVQGFPTLKIFRSGGKNIQEYKGPREAEGIVEYLKKQVGPASKEIKAPEDATYL 165          

HSP 3 Score: 95.9005 bits (237), Expect = 3.452e-19
Identity = 49/111 (44.14%), Postives = 69/111 (62.16%), Query Frame = 1
Query:  433 VVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFF-PKGHKDGEEYGGGRYLEDFVSFINEKCGTS 762
            V V+ ADN  ++V   +K+VL+EFYAPWCGHCK LAP  ++ AA    E+DVV+A +DA    D+  ++ V G+PTL F  P G K    Y GGR  ++ V +I +   T+
Sbjct:  384 VKVVVADNIHDVVFKSAKNVLIEFYAPWCGHCKKLAPILDEAAATLQSEEDVVIAKIDATA-NDVPGEFDVQGYPTLYFVTPSGKK--VSYEGGRTADEIVDYIKKNKETA 491          

HSP 4 Score: 78.9518 bits (193), Expect = 4.367e-14
Identity = 42/117 (35.90%), Postives = 67/117 (57.26%), Query Frame = 1
Query:   73 DDVVVLTEDNFEKEVGQD-RGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNEGGTNVKIAA 420
            + V V+  DN    V +  +  L+EFYAPWCGHCKKLAP  ++  A+ +  + V+I K+D   +  +  ++ VQGYPT+ +F   S +   YEG R+ + + +Y+     T  + AA
Sbjct:  382 EPVKVVVADNIHDVVFKSAKNVLIEFYAPWCGHCKKLAPILDEAAATLQSEEDVVIAKIDATAN-DVPGEFDVQGYPTL-YFVTPSGKKVSYEGGRTADEIVDYIKKNKETAGQAAA 496          
BLAST of EY659499 vs. ExPASy Swiss-Prot
Match: PDI_HORVU (Protein disulfide-isomerase OS=Hordeum vulgare GN=PDI PE=1 SV=2)

HSP 1 Score: 107.842 bits (268), Expect = 8.779e-23
Identity = 54/131 (41.22%), Postives = 76/131 (58.02%), Query Frame = 1
Query:   61 SALADDVVVLTEDNFEKEVGQDRGALVEFYAPWCGHCKKLAPEYEKLGASFKK-AKSVLIGKVDCDEHKS--LCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNEGGTNVKIAAVPSNVVVL 444
            +A  + V+ L  DNF+  +GQ    LVEFYAPWCGHCK LAPEYEK      K   ++++ KVD ++ K+  L  KY VQG+PT++ F  G    ++Y+GPR  E + EY+  + G   K    P +   L
Sbjct:   34 AAAPEAVLTLHADNFDDAIGQHPFILVEFYAPWCGHCKSLAPEYEKAAQLLSKHDPAIVLAKVDANDEKNKPLAGKYEVQGFPTLKIFRNGGKSIQEYKGPREAEGIVEYLKKQVGPASKEIKAPEDATYL 164          

HSP 2 Score: 107.842 bits (268), Expect = 8.779e-23
Identity = 58/117 (49.57%), Postives = 74/117 (63.25%), Query Frame = 1
Query:  415 AAVPSNVVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAFALEDD-VVVANLDA--DKYKDLAEKYGVSGFPTLKFFPKGHKDGEEYGGGRYLEDFVSFINEKCG 756
            AA P  V+ L ADNFD+ +  +   +LVEFYAPWCGHCK+LAP YEK A   +  D  +V+A +DA  +K K LA KY V GFPTLK F  G K  +EY G R  E  V ++ ++ G
Sbjct:   34 AAAPEAVLTLHADNFDDAI-GQHPFILVEFYAPWCGHCKSLAPEYEKAAQLLSKHDPAIVLAKVDANDEKNKPLAGKYEVQGFPTLKIFRNGGKSIQEYKGPREAEGIVEYLKKQVG 149          

HSP 3 Score: 95.9005 bits (237), Expect = 3.452e-19
Identity = 49/111 (44.14%), Postives = 69/111 (62.16%), Query Frame = 1
Query:  433 VVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFF-PKGHKDGEEYGGGRYLEDFVSFINEKCGTS 762
            V V+ ADN  ++V    K+VL+EFYAPWCGHCK LAP  ++ AA    E+DVV+A +DA +  D+  ++ V G+PTL F  P G K    Y GGR  ++ V +I +   T+
Sbjct:  383 VKVVVADNVHDVVFKSGKNVLIEFYAPWCGHCKKLAPILDEAAATLQSEEDVVIAKMDATE-NDVPGEFDVQGYPTLYFVTPSGKK--VSYEGGRTADEIVDYIRKNKETA 490          

HSP 4 Score: 80.1073 bits (196), Expect = 1.960e-14
Identity = 43/117 (36.75%), Postives = 68/117 (58.12%), Query Frame = 1
Query:   73 DDVVVLTEDNFEKEVGQD-RGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNEGGTNVKIAA 420
            + V V+  DN    V +  +  L+EFYAPWCGHCKKLAP  ++  A+ +  + V+I K+D  E+  +  ++ VQGYPT+ +F   S +   YEG R+ + + +Y+     T  + AA
Sbjct:  381 EPVKVVVADNVHDVVFKSGKNVLIEFYAPWCGHCKKLAPILDEAAATLQSEEDVVIAKMDATEN-DVPGEFDVQGYPTL-YFVTPSGKKVSYEGGRTADEIVDYIRKNKETAGQAAA 495          
BLAST of EY659499 vs. ExPASy Swiss-Prot
Match: PDI_ASPNG (Protein disulfide-isomerase OS=Aspergillus niger GN=pdiA PE=2 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 2.554e-22
Identity = 80/223 (35.87%), Postives = 115/223 (51.57%), Query Frame = 1
Query:   25 WLALSTLTLFFVSALAD---DVVVLTEDNFEKEVGQDRGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNEGGTNVKIAAVPSNVVVLTADNFDEI-VLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAA------FALEDDVVVANLDADK------YKDLAEKYGV 645
            WL +S L    V A AD   DV+ L +D FE  + +    L EF+APWCGHCK LAP+YE+  A+  KAK++ + KVDC   + LC   GV+GYPT++ F +G    K Y+G R TE++  Y+  +      + AV S    +  +N +EI  +DK   ++V  Y P     +     +EK A +      FA  DD  +A  +  +      YKD  EK  V
Sbjct:    7 WL-VSLLGASAVVAAADTESDVISLDQDTFESFMNEHGLVLAEFFAPWCGHCKALAPKYEE-AATELKAKNIPLVKVDCTAEEDLCRSQGVEGYPTLKIF-RGVDSSKPYQGARQTESIVSYMIKQ-----SLPAVSS----VNEENLEEIKTMDK---IVVIGYIP--SDDQETYQAFEKYAESQRDNYLFAATDDAAIAKSEGVEQPSIVLYKDFDEKKAV 212          

HSP 2 Score: 100.523 bits (249), Expect = 1.402e-20
Identity = 53/124 (42.74%), Postives = 78/124 (62.90%), Query Frame = 1
Query:  403 NVKIAAVPSN----VVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAFALEDD----VVVANLDADKYKDLAEKYGVSGFPTLKFFPKGHKDGE-EYGGGRYLEDFVSFINE 747
            ++K   VP +    V V+ A ++ ++V+D  KDVL+EFYAPWCGHCK LAP Y+++AA +A   D    V +A +DA    D+ +   ++GFPTL+ +P G KD   EY G R +ED  +F+ E
Sbjct:  347 SIKSEPVPESQEGPVTVVVAHSYKDLVIDNDKDVLLEFYAPWCGHCKALAPKYDELAALYADHPDLAAKVTIAKIDATA-NDVPDP--ITGFPTLRLYPAGAKDSPIEYSGSRTVEDLANFVKE 467          

HSP 3 Score: 79.7221 bits (195), Expect = 2.560e-14
Identity = 43/112 (38.39%), Postives = 61/112 (54.46%), Query Frame = 1
Query:  406 VKIAAVPSNVVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGHKDGEEYGGGRYLEDFVSFI 741
            V  A   S+V+ L  D F+  + +    VL EF+APWCGHCK LAP YE+ A     ++ + +  +D    +DL    GV G+PTLK F +G    + Y G R  E  VS++
Sbjct:   18 VAAADTESDVISLDQDTFESFMNEHGL-VLAEFFAPWCGHCKALAPKYEEAATELKAKN-IPLVKVDCTAEEDLCRSQGVEGYPTLKIF-RGVDSSKPYQGARQTESIVSYM 126          

HSP 4 Score: 78.9518 bits (193), Expect = 4.367e-14
Identity = 44/121 (36.36%), Postives = 65/121 (53.72%), Query Frame = 1
Query:   82 VVLTEDNFEKEVGQDRGALVEFYAPWCGHCKKLAPEYEKLGASFKK----AKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLE-PKKYEGPRSTEALAEYVNNEGGTNVKIAAVPS 429
            VV+     +  +  D+  L+EFYAPWCGHCK LAP+Y++L A +      A  V I K+D   +        + G+PT++ +P G+ + P +Y G R+ E LA +V   G  NV    V S
Sbjct:  363 VVVAHSYKDLVIDNDKDVLLEFYAPWCGHCKALAPKYDELAALYADHPDLAAKVTIAKIDATAND---VPDPITGFPTLRLYPAGAKDSPIEYSGSRTVEDLANFVKENGKHNVDALNVAS 480          
The following BLAST results are available for this feature:
BLAST of EY659499 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 87
Match NameE-valueIdentityDescription
DJC10_MOUSE2.729e-2430.85DnaJ homolog subfamily C member 10 OS=Mus musculus... [more]
PDIA3_MOUSE3.564e-2440.14Protein disulfide-isomerase A3 OS=Mus musculus GN=... [more]
DJC10_PONAB3.564e-2428.76DnaJ homolog subfamily C member 10 OS=Pongo abelii... [more]
DJC10_HUMAN4.655e-2427.97DnaJ homolog subfamily C member 10 OS=Homo sapiens... [more]
DJC10_RAT6.080e-2430.35DnaJ homolog subfamily C member 10 OS=Rattus norve... [more]
ERP60_SCHMA1.037e-2334.23Probable protein disulfide-isomerase ER-60 OS=Schi... [more]
DJC10_XENLA1.037e-2328.90DnaJ homolog subfamily C member 10 OS=Xenopus laev... [more]
PDI_WHEAT1.769e-2348.00Protein disulfide-isomerase OS=Triticum aestivum G... [more]
PDI_HORVU8.779e-2341.22Protein disulfide-isomerase OS=Hordeum vulgare GN=... [more]
PDI_ASPNG2.554e-2235.87Protein disulfide-isomerase OS=Aspergillus niger G... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-009-G10-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659499 ID=EY659499|Name=EY659499|organism=Citrus sinensis|type=EST|length=922bp
ANAGATATTGAGAGGTATCAGATCTGGCTAGCTCTCAGCACTTTAACCTT
GTTCTTCGTATCAGCTCTAGCGGACGATGTCGTTGTGCTAACAGAAGACA
ACTTCGAGAAGGAGGTTGGTCAGGACAGGGGAGCTCTTGTTGAGTTTTAC
GCTCCTTGGTGTGGCCACTGTAAAAAGCTTGCTCCAGAGTATGAGAAACT
TGGTGCAAGCTTTAAGAAAGCAAAGTCTGTCTTGATTGGAAAGGTGGACT
GTGACGAGCATAAGAGCTTATGCAGCAAATATGGTGTTCAAGGATACCCA
ACAATTCAATGGTTTCCTAAAGGTTCTTTGGAACCCAAAAAGTATGAAGG
GCCACGATCTACTGAAGCCCTTGCTGAGTATGTGAATAATGAAGGAGGAA
CCAATGTGAAGATAGCTGCAGTCCCATCCAATGTGGTGGTACTAACAGCT
GATAATTTTGATGAGATAGTTTTGGACAAAAGCAAAGATGTTTTGGTTGA
ATTTTATGCACCATGGTGTGGCCATTGCAAAAACCTTGCGCCTACATATG
AAAAGGTGGCAGCCGCATTTGCATTGGAAGATGATGTAGTCGTTGCTAAT
TTGGATGCTGACAAATACAAGGATCTGGCTGAGAAGTATGGAGTTAGTGG
ATTTCCTACATTGAAGTTCTTTCCAAAAGGGCACAAAGATGGTGAGGAAT
ATGGGGGTGGCAGATATTTGGAAGACTTTGTTTCTTTCATCAATGAAAAA
TGTGGCACCAGTCGTGATGGAAAAGGACAACTTACTTCAACGGNGGTATA
GTTGCGAGCTTAAAGCCTNGGTGAAAGGATTTGTTGCTGCTACCGGTGAT
GAAAAAAGGCAGTCTTCTCAANATTGACCGGGAGTTTGAGTGCTTGAGGC
TCCACTGCGGCATGGGAAGATT
back to top