EY659357

Overview
NameEY659357
Unique NameEY659357
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length869
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6052 contig Csv1_Contig6052:357..1226. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659357 vs. ExPASy Swiss-Prot
Match: FBRL_ENCCU (rRNA 2'-O-methyltransferase fibrillarin OS=Encephalitozoon cuniculi GN=NOP1 PE=3 SV=1)

HSP 1 Score: 219.55 bits (558), Expect = 2.674e-57
Identity = 111/173 (64.16%), Postives = 139/173 (80.35%), Query Frame = 2
Query:  239 KVVVEPH-RHEGVFIAKGKEDALVTKNLVAGEAVYNEKRISVQNEDGTKVEYRIWNPFRSKLAAAVLGGVDNIWIKPGVRVLYLGAASGTTVSHVSDIVGPNGVVYAVEFSHRSGRDFGHMAKKRTNVIPIIXDARHPAXYRMLVGMVDCIFSDVAPPDQARILPLMHHIFSK 754
            KV+VEPH R  GV+I++GKED L+T+NLV G +VY EKR++V  E G KVEYR+WN +RSKLAA ++ G +NI ++PG +VLYLGA+SGTTVSHVSDIVG +GVVYAVEFS RSGRD  +M+ KR N++PII DAR+P+ YRMLV +VDCIFSDV+ PDQ RI+ L    F K
Sbjct:   46 KVLVEPHPRFPGVYISRGKEDLLLTRNLVPGVSVYGEKRVAVDLE-GMKVEYRVWNAYRSKLAAGIVCGAENIHMEPGSKVLYLGASSGTTVSHVSDIVGKDGVVYAVEFSERSGRDLINMSMKRPNIVPIIEDARYPSRYRMLVPIVDCIFSDVSQPDQTRIVALNAQYFLK 217          

HSP 2 Score: 23.0978 bits (48), Expect = 2.674e-57
Identity = 10/17 (58.82%), Postives = 12/17 (70.59%), Query Frame = 1
Query:  733 DASYFLKAGGHFVISIK 783
            +A YFLK GG   +SIK
Sbjct:  211 NAQYFLKEGGGVDVSIK 227          
BLAST of EY659357 vs. ExPASy Swiss-Prot
Match: FBRL_GIALA (rRNA 2'-O-methyltransferase fibrillarin OS=Giardia lamblia PE=3 SV=1)

HSP 1 Score: 215.312 bits (547), Expect = 3.570e-55
Identity = 119/204 (58.33%), Postives = 145/204 (71.08%), Query Frame = 2
Query:  236 SKVVVEPH-RHEGVFIAKGKEDALVTKNLVAGEAVYNEKRISVQNEDGTKVEYRIWNPFRSKLAAAVLGGVDNIWIKPGVRVLYLGAASGTTVSHVSDIVGPNGVVYAVEFSHRSGRDFGHMAKKRTNVIPIIXDARHPAXYRMLVGMVDCIFSDVAPPDQARILPLMHHIFSKLE-VILLFLSRKLHRFTCSAGAVFQSEVKT 841
            +K +V+PH +++G+FI+ G+ D LVTK+L  G AVY EKRISV+  + +K+EYR WNPFRSKL AAV   V ++ IKPG +VLYLGAASGTTVSHVSDIVGP G VYAVEFS RSGRD   +AK RTNV PII DARHP  YRM+V  VDCIFSDVA PDQARI+      + K    +L+ +       T    AVF  E++T
Sbjct:   92 AKTMVKPHPKYDGIFISHGRGDVLVTKSLAPGVAVYGEKRISVEGTE-SKIEYREWNPFRSKLGAAVRLNVLDMPIKPGAKVLYLGAASGTTVSHVSDIVGPTGAVYAVEFSQRSGRDLLEVAKARTNVYPIIADARHPYKYRMIVPEVDCIFSDVAQPDQARIVAENARYYLKANGGMLISIKASSVDSTLKPEAVFAREIET 294          
BLAST of EY659357 vs. ExPASy Swiss-Prot
Match: FBRL_LEIMA (rRNA 2'-O-methyltransferase fibrillarin OS=Leishmania major PE=3 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 2.025e-54
Identity = 107/174 (61.49%), Postives = 130/174 (74.71%), Query Frame = 2
Query:  236 SKVVVEPHR-HEGVFIAKGKEDALVTKNLVAGEAVYNEKRISVQNEDG--TKVEYRIWNPFRSKLAAAVLGGVDNIWIKPGVRVLYLGAASGTTVSHVSDIVGPNGVVYAVEFSHRSGRDFGHMAKKRTNVIPIIXDARHPAXYRMLVGMVDCIFSDVAPPDQARILPLMHHIF 748
            +KV+VEPH  H GVFI+K K D+L T N+V G +VY EKRI +    G   K EYR+WNP+RSKLA+A+  GV +I + PG +VLYLG A+GTTVSHVSD+VGP G+VYAVEFSHR GRD   M+K+R  ++PI+ DAR+P  YRMLV MVDCIF DVA PDQARIL L    F
Sbjct:   57 AKVIVEPHMLHPGVFISKAKTDSLCTLNMVPGISVYGEKRIELGATQGGDDKKEYRLWNPYRSKLASAIYAGVSSIHMGPGSKVLYLGGATGTTVSHVSDLVGPEGMVYAVEFSHRVGRDLVEMSKRRP-IVPIVEDARYPMKYRMLVPMVDCIFMDVAQPDQARILALNAQAF 229          

HSP 2 Score: 26.1794 bits (56), Expect = 2.025e-54
Identity = 11/17 (64.71%), Postives = 14/17 (82.35%), Query Frame = 1
Query:  733 DASYFLKAGGHFVISIK 783
            +A  FL+ GGH+VISIK
Sbjct:  225 NAQAFLQNGGHYVISIK 241          
BLAST of EY659357 vs. ExPASy Swiss-Prot
Match: FLPA_THEGJ (Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=flpA PE=3 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 5.718e-38
Identity = 85/162 (52.47%), Postives = 105/162 (64.81%), Query Frame = 2
Query:  248 VEPHRHEGVFIAKGKE--DALVTKNLVAGEAVYNEKRISVQNEDGTKVEYRIWNPFRSKLAAAVLGGVDNIWIKPGVRVLYLGAASGTTVSHVSDIVGPNGVVYAVEFSHRSGRDFGHMAKKRTNVIPIIXDARHPAXYRMLVGMVDCIFSDVAPPDQARIL 727
            V+ HR  GV+I    +  + + TKNLV G+ VY E+ I  + E     EYRIWNP RSKL AA+L G+ N  IKPG  VLYLG ASGTT SHVSDIVG  G ++ VEFS R  R+   + ++R N++PI+ DA  P  YR LV  VD IF DVA P QA+IL
Sbjct:    3 VKKHRFPGVYIVIDDDGSEKIATKNLVPGQRVYGERVIKFEGE-----EYRIWNPSRSKLGAAILNGLKNFPIKPGSTVLYLGIASGTTASHVSDIVGWEGKIFGVEFSPRVLRELVPIVEERRNIVPILGDATKPEGYRALVPKVDVIFEDVAQPTQAKIL 159          

HSP 2 Score: 23.0978 bits (48), Expect = 5.718e-38
Identity = 9/17 (52.94%), Postives = 14/17 (82.35%), Query Frame = 1
Query:  733 DASYFLKAGGHFVISIK 783
            +A  FLK+GG+ +IS+K
Sbjct:  162 NAKVFLKSGGYGMISVK 178          
BLAST of EY659357 vs. ExPASy Swiss-Prot
Match: FLPA_PYRKO (Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Pyrococcus kodakaraensis GN=flpA PE=3 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 7.449e-38
Identity = 85/162 (52.47%), Postives = 105/162 (64.81%), Query Frame = 2
Query:  248 VEPHRHEGVFIAKGKE--DALVTKNLVAGEAVYNEKRISVQNEDGTKVEYRIWNPFRSKLAAAVLGGVDNIWIKPGVRVLYLGAASGTTVSHVSDIVGPNGVVYAVEFSHRSGRDFGHMAKKRTNVIPIIXDARHPAXYRMLVGMVDCIFSDVAPPDQARIL 727
            V+ HR  GV+I    +  + + TKNLV G+ VY E+ +  + E     EYRIWNP RSKL AA+L G+ N  IKPG  VLYLG ASGTT SHVSDIVG  G V+ VEFS R  R+   + ++R N++PI+ DA  P  YR LV  VD IF DVA P QA+IL
Sbjct:    3 VKKHRFPGVYIVIDDDGSEKIATKNLVPGQRVYGERVVKFEGE-----EYRIWNPTRSKLGAAILNGLKNFPIKPGSTVLYLGVASGTTASHVSDIVGWEGKVFGVEFSPRVLRELVPLVEERRNIVPILGDATKPEGYRALVPKVDVIFEDVAQPTQAKIL 159          

HSP 2 Score: 21.9422 bits (45), Expect = 7.449e-38
Identity = 8/17 (47.06%), Postives = 14/17 (82.35%), Query Frame = 1
Query:  733 DASYFLKAGGHFVISIK 783
            +A  +LK+GG+ +IS+K
Sbjct:  162 NAKVYLKSGGYGMISVK 178          
BLAST of EY659357 vs. ExPASy Swiss-Prot
Match: FLPA_THEON (Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Thermococcus onnurineus (strain NA1) GN=flpA PE=3 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 2.795e-37
Identity = 83/162 (51.23%), Postives = 105/162 (64.81%), Query Frame = 2
Query:  248 VEPHRHEGV--FIAKGKEDALVTKNLVAGEAVYNEKRISVQNEDGTKVEYRIWNPFRSKLAAAVLGGVDNIWIKPGVRVLYLGAASGTTVSHVSDIVGPNGVVYAVEFSHRSGRDFGHMAKKRTNVIPIIXDARHPAXYRMLVGMVDCIFSDVAPPDQARIL 727
            ++ H+  GV  FI +   + + TKNLV G+ VY E+ I  + E     EYR+WNP RSKL AA+L G+ +  IKPG  VLYLG ASGTT SHVSDIVG  G V+ VEFS R  R+   + ++R N++PI+ DA  P  YR LV  VD IF DVA P QA+IL
Sbjct:    3 IKKHKFPGVYVFIDEDGSEKIATKNLVPGQKVYGERLIKFEGE-----EYRVWNPRRSKLGAAILNGLKHFPIKPGSTVLYLGVASGTTASHVSDIVGWEGKVFGVEFSPRVLRELVPIVEERRNIVPILGDATKPEGYRALVPKVDVIFEDVAQPTQAKIL 159          

HSP 2 Score: 23.0978 bits (48), Expect = 2.795e-37
Identity = 9/17 (52.94%), Postives = 14/17 (82.35%), Query Frame = 1
Query:  733 DASYFLKAGGHFVISIK 783
            +A  FLK+GG+ +IS+K
Sbjct:  162 NAKVFLKSGGYGMISVK 178          
BLAST of EY659357 vs. ExPASy Swiss-Prot
Match: FLPA_PYRFU (Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Pyrococcus furiosus GN=flpA PE=1 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 9.768e-37
Identity = 84/164 (51.22%), Postives = 106/164 (64.63%), Query Frame = 2
Query:  242 VVVEPHRHEGVFIAKGKE--DALVTKNLVAGEAVYNEKRISVQNEDGTKVEYRIWNPFRSKLAAAVLGGVDNIWIKPGVRVLYLGAASGTTVSHVSDIVGPNGVVYAVEFSHRSGRDFGHMAKKRTNVIPIIXDARHPAXYRMLVGMVDCIFSDVAPPDQARIL 727
            V V+ H+  GV++    +  + + TKNLV G+ VY E+ I  + E     EYRIWNP RSKL AA++ G+ N  IKPG  VLYLG ASGTT SHVSDIVG  G +Y +EFS R  R+   + ++R N+IPI+ DA  P  YR LV  VD IF DVA P QA+IL
Sbjct:    2 VEVKKHKFPGVYVVIDDDGSEKIATKNLVPGQRVYGERVIKWEGE-----EYRIWNPHRSKLGAAIVNGLKNFPIKPGKSVLYLGIASGTTASHVSDIVGWEGKIYGIEFSPRVLRELVPIVEERRNIIPILGDATKPEEYRALVTKVDVIFEDVAQPTQAKIL 160          
BLAST of EY659357 vs. ExPASy Swiss-Prot
Match: FLPA_THESM (Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=flpA PE=3 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 3.020e-36
Identity = 81/162 (50.00%), Postives = 104/162 (64.20%), Query Frame = 2
Query:  248 VEPHRHEGVF--IAKGKEDALVTKNLVAGEAVYNEKRISVQNEDGTKVEYRIWNPFRSKLAAAVLGGVDNIWIKPGVRVLYLGAASGTTVSHVSDIVGPNGVVYAVEFSHRSGRDFGHMAKKRTNVIPIIXDARHPAXYRMLVGMVDCIFSDVAPPDQARIL 727
            V+ H+  GV+  I     + + TKNLV G+ VY E+ +  + E     EYRIWNP RSKLAAA+L  + N  IKPG  VLYLG ASGTT SHVSDI+G  G ++ +EFS R  R+   + ++R N++PI+ DA  P  YR LV  VD IF DVA P QA+IL
Sbjct:    3 VKKHKFPGVYTVIEDDGSERIATKNLVPGQKVYGERIVKWKGE-----EYRIWNPNRSKLAAAILNDLKNFPIKPGTTVLYLGIASGTTASHVSDIIGWEGKIFGIEFSPRVLRELVPLVEERRNIVPILGDATKPEEYRALVTKVDVIFEDVAQPTQAKIL 159          

HSP 2 Score: 21.9422 bits (45), Expect = 3.020e-36
Identity = 9/17 (52.94%), Postives = 14/17 (82.35%), Query Frame = 1
Query:  733 DASYFLKAGGHFVISIK 783
            +A  +LK+GG+ +ISIK
Sbjct:  162 NAKAYLKSGGYGMISIK 178          
BLAST of EY659357 vs. ExPASy Swiss-Prot
Match: FLPA_PYRAB (Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Pyrococcus abyssi GN=flpA PE=3 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 6.331e-36
Identity = 81/164 (49.39%), Postives = 105/164 (64.02%), Query Frame = 2
Query:  242 VVVEPHRHEGVFIAKGKE--DALVTKNLVAGEAVYNEKRISVQNEDGTKVEYRIWNPFRSKLAAAVLGGVDNIWIKPGVRVLYLGAASGTTVSHVSDIVGPNGVVYAVEFSHRSGRDFGHMAKKRTNVIPIIXDARHPAXYRMLVGMVDCIFSDVAPPDQARIL 727
            V V+ H+  GV+I    +  + + TKNLV G+ VY E+ I  + E     EYRIWNP RSKL AA++ G+ N  IKPG  VLYLG ASGTT SHVSD++G  G ++ +EFS R  R+   + + R N++PI+ DA  P  YR LV  VD IF DVA P QA+IL
Sbjct:    2 VEVKKHKFPGVYIVIDDDGSEKIATKNLVPGQRVYGERVIKWEGE-----EYRIWNPHRSKLGAAIMNGLKNFPIKPGKSVLYLGIASGTTASHVSDVIGWEGKIFGIEFSPRVLRELVPIVEDRKNIVPILGDATKPEEYRALVPKVDVIFEDVAQPTQAKIL 160          
BLAST of EY659357 vs. ExPASy Swiss-Prot
Match: FLPA_PYRHO (Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Pyrococcus horikoshii GN=flpA PE=1 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 8.269e-36
Identity = 83/164 (50.61%), Postives = 105/164 (64.02%), Query Frame = 2
Query:  242 VVVEPHRHEGVF--IAKGKEDALVTKNLVAGEAVYNEKRISVQNEDGTKVEYRIWNPFRSKLAAAVLGGVDNIWIKPGVRVLYLGAASGTTVSHVSDIVGPNGVVYAVEFSHRSGRDFGHMAKKRTNVIPIIXDARHPAXYRMLVGMVDCIFSDVAPPDQARIL 727
            V V+ H+  GV+  I     + + TKNLV G+ VY E+ I  + E     EYRIWNP RSKL AA++ G+ N  IKPG  VLYLG ASGTT SHVSDIVG  G ++ +EFS R  R+   + ++R N++PI+ DA  P  YR LV  VD IF DVA P QA+IL
Sbjct:    2 VEVKKHKFPGVYTVIDDDGSERIATKNLVPGQRVYGERVIKWEGE-----EYRIWNPNRSKLGAAIMNGLKNFPIKPGKSVLYLGIASGTTASHVSDIVGWEGKIFGIEFSPRVLRELVPIVEERRNIVPILGDATKPEEYRALVPKVDVIFEDVAQPTQAKIL 160          
The following BLAST results are available for this feature:
BLAST of EY659357 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 73
Match NameE-valueIdentityDescription
FBRL_ENCCU2.674e-5764.16rRNA 2'-O-methyltransferase fibrillarin OS=Encepha... [more]
FBRL_GIALA3.570e-5558.33rRNA 2'-O-methyltransferase fibrillarin OS=Giardia... [more]
FBRL_LEIMA2.025e-5461.49rRNA 2'-O-methyltransferase fibrillarin OS=Leishma... [more]
FLPA_THEGJ5.718e-3852.47Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase ... [more]
FLPA_PYRKO7.449e-3852.47Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase ... [more]
FLPA_THEON2.795e-3751.23Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase ... [more]
FLPA_PYRFU9.768e-3751.22Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase ... [more]
FLPA_THESM3.020e-3650.00Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase ... [more]
FLPA_PYRAB6.331e-3649.39Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase ... [more]
FLPA_PYRHO8.269e-3650.61Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-002-C06-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659357 ID=EY659357|Name=EY659357|organism=Citrus sinensis|type=EST|length=869bp
CCACGCGTCCGCTTTGTAGCCGGACAGAGCATCAAACATGAGACCTCCAA
GAGGACGCGGTGGTGGCGGTGGGTTCAGGGGAGGCAGAGGTGATGGAGGA
GGAAGAGGAAGAGGTGGCGGCCGAGGTGGTGGAGGTGGAAGAGGTGGTGG
TAGCGCTATGAGAGGCCGAGGTGGCGGTCGTGGCGGTGGCCGAGGTGGAG
GAAGAGGACGCGGTGGTGGAGGAATGAAGGGTGGAAGCAAGGTTGTAGTT
GAGCCTCATAGACACGAAGGAGTGTTCATTGCCAAGGGCAAAGAAGACGC
CCTTGTCACTAAGAATCTCGTCGCCGGTGAGGCTGTCTACAATGAGAAGA
GGATCTCCGTCCAGAATGAAGATGGAACCAAAGTTGAGTATAGAATTTGG
AATCCCTTCCGTTCCAAATTAGCTGCAGCTGTTCTTGGTGGTGTTGATAA
TATTTGGATTAAACCTGGTGTTAGGGTTCTATACCTTGGTGCTGCTTCCG
GCACAACTGTCTCACATGTTTCGGACATTGTTGGCCCTAATGGAGTAGTT
TATGCAGTGGAATTTTCTCATAGAAGTGGTAGAGACTTTGGTCATATGGC
AAAGAAGAGAACCAATGTTATACCCATAATTNGAGATGCTAGACATCCTG
CCNAGTACCGTATGTTGGTCGGTATGGTAGATTGTATATTTTCTGACGTT
GCCCCACCGGATCAGGCGAGGATTTTACCCCTGATGCATCATATTTTCTC
AAAGCTGGAGGTCATTTTGTTATTTCTATCAAGGAAACTGCATAGATTCA
CCTGTTCTGCTGGAGCAGTGTTCCAGAGTGAAGTTAAGACCTGCAACAGG
TCATTCCAACCCTTGAGCA
back to top