EY659357

Overview
NameEY659357
Unique NameEY659357
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length869
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6052 contig Csv1_Contig6052:357..1226. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659357 vs. ExPASy Swiss-Prot
Match: FLPA_METTH (Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Methanobacterium thermoautotrophicum GN=flpA PE=3 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 2.257e-25
Identity = 75/191 (39.27%), Postives = 106/191 (55.50%), Query Frame = 2
Query:  266 EGVFIAKGKEDALVTKNLVAGEAVYNEKRISVQNEDGTKVEYRIWNPFRSKLAAAVLGGVDNIWIKPGVRVLYLGAASGTTVSHVSDIVGPNGVVYAVEFSHRSGRDFGHMAKKRTNVIPIIXDARHPAXYRMLVGMVDCIFSDVAPPDQARILPLMHHIFSKLEVI-LLFLSRKLHRFTCSAGAVFQSEV 835
            +GVFI     ++L+T N   G  VY E+ I     D    EYR+W+P RSKLAAA+L G+    +    RVLYLGA++GTT SH+SDIV  +G VY +EFS R  R+   + + R N+ P++ DA  P  Y  +V   D ++ DVA PDQ R+       F K +   L+ +  +    T S   +F+ EV
Sbjct:   11 DGVFIMN---NSLLTINPNPGVKVYGERII-----DWGGREYRVWDPRRSKLAAAILNGLRGFSLNSDSRVLYLGASAGTTASHISDIV-TDGRVYCIEFSPRMMRELLGVCESRKNMAPLLEDASRPLSYLRMVEAADLVYCDVAQPDQTRLFIENMDCFLKRDGYGLIMIKARSIDVTRSPRKIFREEV 192          
BLAST of EY659357 vs. ExPASy Swiss-Prot
Match: FLPA_METMJ (Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=flpA PE=3 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 1.014e-22
Identity = 56/113 (49.56%), Postives = 76/113 (67.26%), Query Frame = 2
Query:  389 YRIWNPFRSKLAAA-VLGGVDNIWIKPGVRVLYLGAASGTTVSHVSDIVGPNGVVYAVEFSHRSGRDFGHMAKKRTNVIPIIXDARHPAXYRMLVGMVDCIFSDVAPPDQARI 724
            YR+W+P+RSKLAA   LGG   + + P +RVLYLGAA+GTTVSHV+D V     VYAVEF+ R  +D   +A++R N++PI+ DA  P  Y   +  VD ++ DVA P+Q  I
Sbjct:   25 YRVWDPYRSKLAALYTLGG--GVELTPEMRVLYLGAANGTTVSHVADYVE---TVYAVEFAPRPMQDLLEVARRRRNIVPIMADASRPEEYAPFMEAVDLVYQDVAQPNQVEI 132          

HSP 2 Score: 22.3274 bits (46), Expect = 1.014e-22
Identity = 8/13 (61.54%), Postives = 10/13 (76.92%), Query Frame = 1
Query:  745 FLKAGGHFVISIK 783
            FLK GGH V+ +K
Sbjct:  139 FLKPGGHLVLMLK 151          
BLAST of EY659357 vs. ExPASy Swiss-Prot
Match: FLPA_ARCFU (Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Archaeoglobus fulgidus GN=flpA PE=1 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 1.048e-22
Identity = 74/191 (38.74%), Postives = 105/191 (54.97%), Query Frame = 2
Query:  293 EDALVTKNLVAGEAVYNEKRISVQNEDGTKVEYRIWNPFRSKLAAAVLGGVDNIWIKPGVRVLYLGAASGTTVSHVSDIVGPNGVVYAVEFSHRSGRDFGHMAKKRTNVIPIIXDARHPAXYRMLVGMVDCIFSDVAPPDQARILPLMHHIF--SKLEVILLFLSRKLHRFTCSAGAVFQSEVKTCNRSFQ 859
            +D LVTK+       Y EK       DG    YR W P+RSKLAA +L G   + ++   RVLYLGAASGTTVSH++DIV   G++YAVE+S +       + ++R N+IP++ DA  P  Y  +V  VD I+ D+A  +Q  IL      F   K EV+++  +R +   T     VF+S +K     F+
Sbjct:   12 DDTLVTKSKYGSH--YGEKVF-----DG----YREWVPWRSKLAAMILKG-HRLKLRGDERVLYLGAASGTTVSHLADIVD-EGIIYAVEYSAKPFEKLLELVRERNNIIPLLFDASKPWKYSGIVEKVDLIYQDIAQKNQIEILKANAEFFLKEKGEVVIMVKARSIDS-TAEPEEVFKSVLKEMEGDFK 188          
BLAST of EY659357 vs. ExPASy Swiss-Prot
Match: FLPA_THEAC (Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Thermoplasma acidophilum GN=flpA PE=3 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 3.373e-21
Identity = 65/166 (39.16%), Postives = 91/166 (54.82%), Query Frame = 2
Query:  311 KNLVA-GEAVYNE--KRISVQNEDGTKVE---YRIWNPFRSKLAAAVLGGVDNIWIKPGVRVLYLGAASGTTVSHVSDIVGPNGVVYAVEFSHRSGRDFGHMAKKRTNVIPIIXDARHPAXYRMLVGMVDCIFSDVAPPDQARILPLMHHIFSKLEVILLFLSRKL 790
            KN++  G  +Y    K   V  ED  + E   YR W P RSKLAAA+L G+ N+ I     +LYLGA++GTTVSHVSDI  P+G +YAVE ++        +A++R N+ PI+ DA  P  YR  V  VD I+ D++  +Q  I       F      L+  +R +
Sbjct:   19 KNMLRIGNKLYTRTSKNKKVYGEDIIRFEHANYREWRPDRSKLAAAILKGLHNMPIGESSSILYLGASTGTTVSHVSDI-APSGRIYAVEVAYEPFSKLLDLAEQRDNIYPILEDANLPERYRFFVDHVDVIYQDISQRNQIAIFKRNMDEFQPRSAFLVLKTRSI 183          
BLAST of EY659357 vs. ExPASy Swiss-Prot
Match: FLPA_HALMA (Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Haloarcula marismortui GN=flpA PE=3 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 4.405e-21
Identity = 69/181 (38.12%), Postives = 94/181 (51.93%), Query Frame = 2
Query:  287 GKEDALVTKNLVAGEAVYNEKRISVQNEDGTKVEYRIWNPFRSKLAAAVLGGVDNIWIKPGVRVLYLGAASGTTVSHVSDIVGPNGVVYAVEFSHRSGRDFGHMAKKRTNVIPIIXDARHPAXYRMLVGMVDCIFSDVAPPDQARILPLMHHIFSKLEVILLFLSRKLHRFTCSAGAVFQS 829
            G E +L T+    G+ VY E+         T  ++R W+P RSKL A +  G+D   +  G  VLYLGAA+GTTVSHV+D  GP    YAVEF+ R  R+    A+ R N+ P++ DAR P  Y  +V  VD +  DVA   QAR+  L     +    +L  +  +    T    AVF S
Sbjct:   13 GGETSLATQ----GQPVYGER---------TDGDWRRWDPHRSKLGAMLAHGMDT-GLGGGETVLYLGAAAGTTVSHVADFGGPT---YAVEFAPRPVRELLDAAESRRNLFPLLKDARKPESYAHVVEPVDVVVQDVATRGQARVATLNKQFLTDDGRLLAAIKARSEDVTADPDAVFDS 176          
BLAST of EY659357 vs. ExPASy Swiss-Prot
Match: FLPA_METTP (Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Methanosaeta thermophila (strain DSM 6194 / PT) GN=flpA PE=3 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 9.813e-21
Identity = 64/171 (37.43%), Postives = 99/171 (57.89%), Query Frame = 2
Query:  329 EAVYNEKRISVQNEDGTKVEYRIWNPFRSKLAAAVLGGVDNIWIKPGVRVLYLGAASGTTVSHVSDIVGPNGVVYAVEFSHRSGRDFGHMAKKRTNVIPIIXDARHPAXYRMLVGMVDCIFSDVAPPDQARILPLMHHIFSKLE-VILLFLSRKLHRFTCSAGAVFQSEVK 838
            E +Y EK +     DG     R+W+P RSKLAA +L       + P  +VLYLGAA+GTTVS++ DI+   G++YAVE S R+ RD   +A++R N+IP++ DA  P  YR +V  VD ++ DVA  +QA I      I+ K   ++++ +  +    T  +  +F  E++
Sbjct:   24 EPLYGEKIV-----DGL----RVWDPRRSKLAALLLRYPCLEGVVPSGKVLYLGAANGTTVSYLGDIL-TGGMIYAVEISPRAMRDLLLLAEQRENIIPVLGDAARPETYRRIVEPVDLLYQDVAQRNQAEIASRNASIYLKPNGLMVVMIKARSIDSTARSTEIFDEEIR 184          
BLAST of EY659357 vs. ExPASy Swiss-Prot
Match: FLPA_THEVO (Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Thermoplasma volcanium GN=flpA PE=3 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 1.085e-19
Identity = 56/136 (41.18%), Postives = 79/136 (58.09%), Query Frame = 2
Query:  332 AVYNEKRIS--VQNEDGTKVE---YRIWNPFRSKLAAAVLGGVDNIWIKPGVRVLYLGAASGTTVSHVSDIVGPNGVVYAVEFSHRSGRDFGHMAKKRTNVIPIIXDARHPAXYRMLVGMVDCIFSDVAPPDQARI 724
            +VY E      V  E+ TK+    YR W+P RSK AAA+L G+    I+    VLYLGA++GTT+SH+SDI  P G +Y VE S+        +AKKR N+ PI+ DA  P  Y   +  VD ++ D++  +Q +I
Sbjct:   24 SVYTETETPQRVYGEEITKINNRTYREWDPRRSKPAAAILNGLRRFPIRENDSVLYLGASTGTTISHISDIC-PAGTIYGVEVSYEPFSKLLDLAKKRNNLYPILEDANSPEKYSFFIEHVDVMYQDISQRNQIQI 158          
BLAST of EY659357 vs. ExPASy Swiss-Prot
Match: FLPA_PICTO (Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Picrophilus torridus GN=flpA PE=3 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 2.262e-17
Identity = 57/146 (39.04%), Postives = 80/146 (54.79%), Query Frame = 2
Query:  335 VYNEKRISVQNEDGTKVEYRIWNPFRSKLAAAVLGGVDNIWIKPGVRVLYLGAASGTTVSHVSDIVGPNGVVYAVEFSHRSGRDFGHMAKKRTNVIPIIXDARHPAXYRMLVGMVDCIFSDVAPPDQARILPLMHHIFSKLEVILL 772
            VY EK I  +N        R W+P RSKLAAA+L G  +      + +LYLGA++GTTVSH+SDI   +G +YAVE S+ S      +++ R N+ PI+ DA     Y+  V   D I+ D+A  +Q +I      IF     IL+
Sbjct:   25 VYGEKIIRKKNS-----YLREWDPRRSKLAAAILKGFKHANFDKKLNILYLGASTGTTVSHLSDIC-ISGRLYAVELSYDSFVKLYSLSQARNNIFPILEDANLVERYKFFVEKCDFIYQDIAQRNQVQIFNQNADIFKPRSAILI 164          
BLAST of EY659357 vs. ExPASy Swiss-Prot
Match: FLPA_HALLT (Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=flpA PE=3 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 1.123e-16
Identity = 68/194 (35.05%), Postives = 90/194 (46.39%), Query Frame = 2
Query:  287 GKEDALVTKNLVAGEAVYNEKRISVQNEDGTKVEYRIWNPFRSKLAAAVLGGVDNIWIKPGVRVLYLGAASGTTVSHVSDIVGPNGVVYAVEFSHRSGRDFGHMAKKRTNVIPIIXDARHPAXYRMLV-GMVDCIFSDVAPPDQARILPLMHHIFSKLEVILLFLSRKLHRFTCSAGAVFQSEVKTCNRSFQPL 865
            G E  L T+    G  VY E        DG    +R W+P RSKL      G +   +  G  VLYLGAASGTTVSHV+D  GP    YAVEF+ R  RD    A+ R  + P++ DAR P  Y  +V   VD I  DVA   QA +        +    +LL +  +    T     VF+  +     +++ L
Sbjct:   16 GGETRLATR----GPPVYGEP-----TADG----WRAWDPGRSKLGGMFELGFET-GLSGGETVLYLGAASGTTVSHVADFAGP---TYAVEFAPRPARDLVEAAEPRDRLFPLLKDARTPKRYAHVVESDVDAIVQDVATRGQAEVAVRNARFLADDGRLLLAIKARSEDVTVEPETVFEGALDRLRETYEIL 192          
BLAST of EY659357 vs. ExPASy Swiss-Prot
Match: FLPA_METHJ (Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Methanospirillum hungatei (strain JF-1 / DSM 864) GN=flpA PE=3 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 1.479e-16
Identity = 57/124 (45.97%), Postives = 73/124 (58.87%), Query Frame = 2
Query:  392 RIWNPFRSKLAAAVLGGVDNIWIKPGVR---VLYLGAASGTTVSHVSDIVGPNGVVYAVEFSHRSGRDFGHMAKKRTNVIPIIXDARHPAXYRMLVGMVDCIFSDVAPPDQARILPLMHHIFSK 754
            RIW+P  SK+AA       +I  +P VR   +LYLGAA+G+TVS +SD      VVYAVEFS R  R    +A+ R N+IP+  DAR+P  Y   V  VD +  D+A  DQA I  L + IF K
Sbjct:   25 RIWDPGHSKVAALC-----HIHGEPPVRNARILYLGAAAGSTVSFLSDYAE---VVYAVEFSPRPVRSLIRLARARKNIIPLFEDARYPERYLPFVEPVDLLIQDIAQRDQAEI-ALRNLIFLK 139          

HSP 2 Score: 21.557 bits (44), Expect = 1.479e-16
Identity = 7/13 (53.85%), Postives = 10/13 (76.92%), Query Frame = 1
Query:  745 FLKAGGHFVISIK 783
            FLK GGH ++ +K
Sbjct:  137 FLKQGGHLILFLK 149          
The following BLAST results are available for this feature:
BLAST of EY659357 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 73
Match NameE-valueIdentityDescription
FLPA_METTH2.257e-2539.27Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase ... [more]
FLPA_METMJ1.014e-2249.56Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase ... [more]
FLPA_ARCFU1.048e-2238.74Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase ... [more]
FLPA_THEAC3.373e-2139.16Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase ... [more]
FLPA_HALMA4.405e-2138.12Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase ... [more]
FLPA_METTP9.813e-2137.43Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase ... [more]
FLPA_THEVO1.085e-1941.18Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase ... [more]
FLPA_PICTO2.262e-1739.04Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase ... [more]
FLPA_HALLT1.123e-1635.05Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase ... [more]
FLPA_METHJ1.479e-1645.97Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-002-C06-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659357 ID=EY659357|Name=EY659357|organism=Citrus sinensis|type=EST|length=869bp
CCACGCGTCCGCTTTGTAGCCGGACAGAGCATCAAACATGAGACCTCCAA
GAGGACGCGGTGGTGGCGGTGGGTTCAGGGGAGGCAGAGGTGATGGAGGA
GGAAGAGGAAGAGGTGGCGGCCGAGGTGGTGGAGGTGGAAGAGGTGGTGG
TAGCGCTATGAGAGGCCGAGGTGGCGGTCGTGGCGGTGGCCGAGGTGGAG
GAAGAGGACGCGGTGGTGGAGGAATGAAGGGTGGAAGCAAGGTTGTAGTT
GAGCCTCATAGACACGAAGGAGTGTTCATTGCCAAGGGCAAAGAAGACGC
CCTTGTCACTAAGAATCTCGTCGCCGGTGAGGCTGTCTACAATGAGAAGA
GGATCTCCGTCCAGAATGAAGATGGAACCAAAGTTGAGTATAGAATTTGG
AATCCCTTCCGTTCCAAATTAGCTGCAGCTGTTCTTGGTGGTGTTGATAA
TATTTGGATTAAACCTGGTGTTAGGGTTCTATACCTTGGTGCTGCTTCCG
GCACAACTGTCTCACATGTTTCGGACATTGTTGGCCCTAATGGAGTAGTT
TATGCAGTGGAATTTTCTCATAGAAGTGGTAGAGACTTTGGTCATATGGC
AAAGAAGAGAACCAATGTTATACCCATAATTNGAGATGCTAGACATCCTG
CCNAGTACCGTATGTTGGTCGGTATGGTAGATTGTATATTTTCTGACGTT
GCCCCACCGGATCAGGCGAGGATTTTACCCCTGATGCATCATATTTTCTC
AAAGCTGGAGGTCATTTTGTTATTTCTATCAAGGAAACTGCATAGATTCA
CCTGTTCTGCTGGAGCAGTGTTCCAGAGTGAAGTTAAGACCTGCAACAGG
TCATTCCAACCCTTGAGCA
back to top