EY659350

Overview
NameEY659350
Unique NameEY659350
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length862
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12632 contig Csv1_Contig12632:598..1460. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659350 vs. ExPASy Swiss-Prot
Match: GCSP_PSE14 (Glycine dehydrogenase [decarboxylating] OS=Pseudomonas syringae pv. phaseolicola (strain 1448A / Race 6) GN=gcvP PE=3 SV=1)

HSP 1 Score: 318.546 bits (815), Expect = 2.960e-86
Identity = 150/250 (60.00%), Postives = 195/250 (78.00%), Query Frame = 2
Query:   23 GKSVP-FTAASLAEEVETAIPSGLTRESPYLTDPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAXGRLTA 769
            G+++P FTA  LA  V + +P+ L R+S  L+ PVFN+YH+E EL+RY+  L  K+L+L  +MIPLGSCTMKLNA +EM+PVTW  F N+HPFAPA+Q+ GYQ++ + L   LC  TG+D+ SLQPNAG+ GEYAGL+ IRAYH++RGD HR++C+IP SAHGTNPATA M GM++V    DA+GN++IE+LR     +RD L+ +M+TYPSTHGV+EEGI EIC I+HDNGGQVY+DGANMNA   L A
Sbjct:  444 GQNLPDFTA--LAASVPSRLPATLLRQSAILSHPVFNRYHSETELMRYLRKLADKDLALDRTMIPLGSCTMKLNAASEMIPVTWAEFGNLHPFAPAEQSTGYQQLTDELEAMLCAATGYDAISLQPNAGSQGEYAGLLAIRAYHQSRGDEHRDICLIPSSAHGTNPATANMAGMRVVVTACDARGNVDIEDLRAKTVQHRDQLAAIMITYPSTHGVFEEGIREICGIVHDNGGQVYIDGANMNAMVGLCA 691          
BLAST of EY659350 vs. ExPASy Swiss-Prot
Match: GCSP_RALEJ (Glycine dehydrogenase [decarboxylating] OS=Ralstonia eutropha (strain JMP134) GN=gcvP PE=3 SV=1)

HSP 1 Score: 317.775 bits (813), Expect = 5.049e-86
Identity = 144/249 (57.83%), Postives = 190/249 (76.31%), Query Frame = 2
Query:   11 LFAGGKSVP--FTAASLAEEVETAIPSGLTRESPYLTDPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNA 751
            +F+ GK +P   T  ++    E A P+ L R S YLT PVFN +H EHE+LRY+ +L  K+L+L  +MIPLGSCTMKLNAT+EM+PVTWP F+ IHPFAP DQ  GY+EM + L   LC  TG+ + SLQPNAG+ GEYAGL++I AYH +RG+ HR++C+IP SAHGTNPA+A M GMK+V V  D  GN+++E+L K AE +  NL+ +M+TYPSTHGV+E+G+ +IC+I+H +GGQVY+DGANMNA
Sbjct:  453 IFSHGKPLPASLTFDAIEAAAEDAFPANLARTSAYLTHPVFNTHHAEHEMLRYLRMLADKDLALDRTMIPLGSCTMKLNATSEMIPVTWPEFSQIHPFAPLDQTVGYREMIDQLEAMLCAATGYAAVSLQPNAGSQGEYAGLLIIHAYHASRGESHRDICLIPSSAHGTNPASAQMAGMKVVVVACDENGNVDLEDLAKKAELHSKNLAAIMITYPSTHGVFEQGVQQICEIVHQHGGQVYVDGANMNA 701          
BLAST of EY659350 vs. ExPASy Swiss-Prot
Match: GCSP1_PSEF5 (Glycine dehydrogenase [decarboxylating] 1 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=gcvP1 PE=3 SV=1)

HSP 1 Score: 317.775 bits (813), Expect = 5.049e-86
Identity = 152/253 (60.08%), Postives = 193/253 (76.28%), Query Frame = 2
Query:   11 LFAGGKSVPFTAASLAEEVETAIPSGLTRESPYLTDPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAXGRLTA 769
            L A GK  P  AA LA  V + IP+ L R+S  L+ PVFN+YH+E EL+RY+  L  K+L+L  +MIPLGSCTMKLNA +EM+P+TW  F  +HPFAPA+Q+ GYQ++   L   LC  TG+D+ SLQPNAG+ GEYAGL+ IRAYH++RGD  R++C+IP SAHGTNPATA M GM++V    DA+GN++IE+LR  A  +R++L+ LM+TYPSTHGV+EEGI EIC IIHDNGGQVY+DGANMNA   L A
Sbjct:  437 LLADGKPAPDFAA-LAAAVTSGIPAALARQSAILSHPVFNRYHSETELMRYLRKLADKDLALDRTMIPLGSCTMKLNAASEMIPITWAEFGALHPFAPAEQSAGYQQLTTELEAMLCAATGYDAVSLQPNAGSQGEYAGLLAIRAYHQSRGDERRDICLIPSSAHGTNPATANMAGMRVVVTACDARGNVDIEDLRAKAIEHREHLAALMITYPSTHGVFEEGIREICGIIHDNGGQVYIDGANMNAMVGLCA 688          
BLAST of EY659350 vs. ExPASy Swiss-Prot
Match: GCSP_SHEWM (Glycine dehydrogenase [decarboxylating] OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=gcvP PE=3 SV=1)

HSP 1 Score: 317.39 bits (812), Expect = 5.740e-86
Identity = 145/233 (62.23%), Postives = 182/233 (78.11%), Query Frame = 2
Query:   71 TAIPSGLTRESPYLTDPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAXGRLTA 769
            T++P+ L R+   LT P FN+YH+E E++RYI  L++K+L+L HSMI LGSCTMKLNA TEMMP+TWP F N+HPF P DQAQGY ++   L EWL  ITG+D+ SLQPN+GA GEYAGL+ I+ YH++RGD HRN+C+IP SAHGTNPA+A + GMKIV    D  GNI++E+L+  A    DNLS +MVTYPSTHGVYEE I EIC++IH +GGQVY+DGANMNA   LT+
Sbjct:  469 TSVPAELVRQDAILTHPTFNRYHSETEMMRYIKRLENKDLALNHSMISLGSCTMKLNAATEMMPITWPEFGNMHPFCPQDQAQGYAQLLGELSEWLVDITGYDAVSLQPNSGAQGEYAGLLAIKQYHESRGDAHRNICLIPSSAHGTNPASAQLAGMKIVVTACDKAGNIDMEDLKAKAAEVADNLSCIMVTYPSTHGVYEETIGEICEVIHQHGGQVYLDGANMNAQVGLTS 701          

HSP 2 Score: 22.7126 bits (47), Expect = 5.740e-86
Identity = 11/20 (55.00%), Postives = 13/20 (65.00%), Query Frame = 1
Query:  766 SPGYIGADVCISSPQHLHSH 825
            SPG+IGADV      HL+ H
Sbjct:  701 SPGFIGADV-----SHLNLH 715          
BLAST of EY659350 vs. ExPASy Swiss-Prot
Match: GCSP_VIBPA (Glycine dehydrogenase [decarboxylating] OS=Vibrio parahaemolyticus GN=gcvP PE=3 SV=1)

HSP 1 Score: 317.005 bits (811), Expect = 8.612e-86
Identity = 147/255 (57.65%), Postives = 193/255 (75.69%), Query Frame = 2
Query:    5 FLLFAGGKSVPFTAASLAEEVETAIPSGLTRESPYLTDPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAXGRLTA 769
            F +F   + V   +  +A     AIP  L R S YLT PVFN YH+E +++RY+  L++K+ SL H MIPLGSCTMKLNA  EM+P+TWP F +IHPFAPA+QA GY  +  +L E LC ITG+D+FSLQPN+GA+GEYAGL+ I+ YH++RG+ HRNVC+IP SAHGTNPATA+M  MK+V V  D +GNI+I++L    E ++DNLS++M+TYPSTHGVYEE + E+C+++H  GGQVY+DGANMNA   LT+
Sbjct:  435 FAIFGVKEDVTALSTEVAGNEFAAIPEALRRTSEYLTHPVFNTYHSETQMMRYLKQLENKDFSLTHGMIPLGSCTMKLNAAAEMIPITWPEFGSIHPFAPAEQAAGYAALAKDLKEKLCEITGYDAFSLQPNSGASGEYAGLIAIQRYHESRGEGHRNVCLIPSSAHGTNPATASMVSMKVVVVKCDDEGNIDIDDLAAKIEKHKDNLSSIMITYPSTHGVYEEKVKEVCEMVHAAGGQVYLDGANMNAQVGLTS 689          
BLAST of EY659350 vs. ExPASy Swiss-Prot
Match: GCSP1_COLP3 (Glycine dehydrogenase [decarboxylating] 1 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=gcvP1 PE=3 SV=1)

HSP 1 Score: 316.62 bits (810), Expect = 9.768e-86
Identity = 146/233 (62.66%), Postives = 184/233 (78.97%), Query Frame = 2
Query:   71 TAIPSGLTRESPYLTDPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAXGRLTA 769
            ++IP+ L RES  LT PVFN YH+E E+LRYI  L++K+L+L HSMI LGSCTMKLNAT +M+PV+WP FAN+HPFAP +QAQGY+ M + L +WL  +TG+D  S+QPN+GA GEYAGL+ I  YH++RGD HRN+C+IP SAHGTNPA+A M  MKIV V  D +GN+++ +L+  AE   DNL+ +M+TYPSTHGVYE  I EIC IIHDNGGQVY+DGANMNA   LT+
Sbjct:  466 SSIPASLVRESAILTHPVFNSYHSETEMLRYIKRLENKDLALNHSMISLGSCTMKLNATAQMIPVSWPEFANMHPFAPVNQAQGYKAMIDELAKWLVELTGYDKMSMQPNSGAQGEYAGLIAISKYHESRGDSHRNICLIPASAHGTNPASAMMVDMKIVIVACDKEGNVDMADLKAKAEELADNLACIMITYPSTHGVYETTIAEICNIIHDNGGQVYLDGANMNAQVGLTS 698          

HSP 2 Score: 22.7126 bits (47), Expect = 9.768e-86
Identity = 11/20 (55.00%), Postives = 13/20 (65.00%), Query Frame = 1
Query:  766 SPGYIGADVCISSPQHLHSH 825
            SPG+IGADV      HL+ H
Sbjct:  698 SPGFIGADV-----SHLNLH 712          
BLAST of EY659350 vs. ExPASy Swiss-Prot
Match: GCSP_ANASP (Glycine dehydrogenase [decarboxylating] OS=Anabaena sp. (strain PCC 7120) GN=gcvP PE=3 SV=1)

HSP 1 Score: 316.62 bits (810), Expect = 1.125e-85
Identity = 154/253 (60.87%), Postives = 188/253 (74.31%), Query Frame = 2
Query:   11 LFAGGKSVPFTAASLAEEVETAIPSG------LTRESPYLTDPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNA 751
            +FAG   +PF      +E +  I          +R+S YLT PVFN+YH+E ELLRY+H L++K+LSL  SMIPLGSCTMKLNAT+EM+PVTW  F  IHPFAP  Q +GYQ +F  L  WL  ITGF   SLQPNAG+ GEY GL+VIR YH++RG+ HRNVC+IP SAHGTNPA+A MCGMK+V+V  DA GNI+I++L+  AE +   L+ LMVTYPSTHGV+E GI EIC +IH +GGQVYMDGANMNA
Sbjct:  460 IFAGTDELPFVLN--VQEFDWIIQQSSLKDEPFSRQSSYLTHPVFNRYHSETELLRYLHRLETKDLSLTTSMIPLGSCTMKLNATSEMIPVTWEEFGRIHPFAPLTQTRGYQILFQQLEAWLGEITGFAGVSLQPNAGSQGEYTGLLVIRQYHQSRGETHRNVCLIPNSAHGTNPASAVMCGMKVVAVACDAGGNIDIDDLKAKAEKHSHELAALMVTYPSTHGVFEAGIQEICAVIHSHGGQVYMDGANMNA 710          
BLAST of EY659350 vs. ExPASy Swiss-Prot
Match: GCSP_IDILO (Glycine dehydrogenase [decarboxylating] OS=Idiomarina loihiensis GN=gcvP PE=3 SV=1)

HSP 1 Score: 315.849 bits (808), Expect = 1.274e-85
Identity = 143/232 (61.64%), Postives = 185/232 (79.74%), Query Frame = 2
Query:   74 AIPSGLTRESPYLTDPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAXGRLTA 769
            +IP+ L R+S YL  PVFN+YH+E E+LRYI  L++K+L+L HSMI LGSCTMKLNAT EM+PVTWP F  +HPF PA+QAQGY E+ + L EWL  +TG+D+ S+QPN+GA GEYAGL+ I+ YH++RGD HRN+C+IP SAHGTNPA+A M  MK+V V  D  GN+++++L+  AE   +NLS +MVTYPSTHGVYEEGI +IC ++H+ GGQVYMDGANMNA   +T+
Sbjct:  464 SIPADLVRQSQYLQHPVFNEYHSETEMLRYIKKLENKDLALNHSMISLGSCTMKLNATAEMIPVTWPEFGQLHPFCPAEQAQGYYELVSTLSEWLIDVTGYDAMSMQPNSGAQGEYAGLLAIQKYHESRGDGHRNICLIPSSAHGTNPASAQMMNMKVVVVDCDKHGNVDMDDLKAKAEEAGENLSCIMVTYPSTHGVYEEGIKDICDLVHNYGGQVYMDGANMNAQVGVTS 695          

HSP 2 Score: 23.0978 bits (48), Expect = 1.274e-85
Identity = 11/20 (55.00%), Postives = 13/20 (65.00%), Query Frame = 1
Query:  766 SPGYIGADVCISSPQHLHSH 825
            SPGYIG+DV      HL+ H
Sbjct:  695 SPGYIGSDV-----SHLNLH 709          
BLAST of EY659350 vs. ExPASy Swiss-Prot
Match: GCSP_THEEB (Glycine dehydrogenase [decarboxylating] OS=Thermosynechococcus elongatus (strain BP-1) GN=gcvP PE=3 SV=1)

HSP 1 Score: 316.235 bits (809), Expect = 1.469e-85
Identity = 147/225 (65.33%), Postives = 177/225 (78.67%), Query Frame = 2
Query:   77 IPSGLTRESPYLTDPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNA 751
            +P+ L R+SPYL  PVF  YH+EH LLRYIH LQ+K+LSL  SMIPLGSCTMKLNAT EM+P++WP F  +HPFAP +QAQGYQ +F  L   L  ITGFD+ SLQPNAG+ GEYAGL+VIR YH +RG+  RNVC+IP SAHGTNPA+A M GM++V+V  DA+GNI++ +L   AE   D L+ LM+TYPSTHGV+E GI +IC IIH  GGQVYMDGANMNA
Sbjct:  461 LPAALKRQSPYLQHPVFQDYHSEHALLRYIHRLQAKDLSLTTSMIPLGSCTMKLNATAEMLPISWPEFNQLHPFAPQEQAQGYQALFRELAAMLAEITGFDAISLQPNAGSQGEYAGLLVIRQYHHSRGESQRNVCLIPTSAHGTNPASAVMAGMQVVAVNCDAQGNIDVADLAAKAETYGDRLAALMITYPSTHGVFETGICQICDIIHRYGGQVYMDGANMNA 685          
BLAST of EY659350 vs. ExPASy Swiss-Prot
Match: GCSP_RALME (Glycine dehydrogenase [decarboxylating] OS=Ralstonia metallidurans (strain CH34 / ATCC 43123 / DSM 2839) GN=gcvP PE=3 SV=1)

HSP 1 Score: 316.235 bits (809), Expect = 1.469e-85
Identity = 144/247 (58.30%), Postives = 189/247 (76.52%), Query Frame = 2
Query:   11 LFAGGKSVPFTAASLAEEVETAIPSGLTRESPYLTDPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNA 751
            +FA GK+VP    ++   V+   P+ L R+S YLT PVFN +H EHE+LRY+  L  K+L+L  +MIPLGSCTMKLNAT+EM+PVTWP F+NIHPFAP DQ  GY+EM + L   LC  TG+ + SLQPNAG+ GEYAGL++I AYH +RG+ HR++C+IP SAHGTNPA+A M GMK+V V  D  GN+++ +L K AE +  NL+ +M+TYPSTHGV+E+G+ +IC I+H +GGQVY+DGANMNA
Sbjct:  454 IFAHGKAVP-DFDTIEASVQDGFPATLARQSAYLTHPVFNTHHAEHEMLRYLRALADKDLALDRTMIPLGSCTMKLNATSEMIPVTWPEFSNIHPFAPLDQTVGYREMIDQLEAMLCAATGYAAVSLQPNAGSQGEYAGLLIIHAYHASRGESHRDICLIPSSAHGTNPASAQMAGMKVVVVACDENGNVDLADLAKKAEQHSKNLAAIMITYPSTHGVFEQGVQQICDIVHKHGGQVYVDGANMNA 699          
The following BLAST results are available for this feature:
BLAST of EY659350 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 368
Match NameE-valueIdentityDescription
GCSP_PSE142.960e-8660.00Glycine dehydrogenase [decarboxylating] OS=Pseudom... [more]
GCSP_RALEJ5.049e-8657.83Glycine dehydrogenase [decarboxylating] OS=Ralston... [more]
GCSP1_PSEF55.049e-8660.08Glycine dehydrogenase [decarboxylating] 1 OS=Pseud... [more]
GCSP_SHEWM5.740e-8662.23Glycine dehydrogenase [decarboxylating] OS=Shewane... [more]
GCSP_VIBPA8.612e-8657.65Glycine dehydrogenase [decarboxylating] OS=Vibrio ... [more]
GCSP1_COLP39.768e-8662.66Glycine dehydrogenase [decarboxylating] 1 OS=Colwe... [more]
GCSP_ANASP1.125e-8560.87Glycine dehydrogenase [decarboxylating] OS=Anabaen... [more]
GCSP_IDILO1.274e-8561.64Glycine dehydrogenase [decarboxylating] OS=Idiomar... [more]
GCSP_THEEB1.469e-8565.33Glycine dehydrogenase [decarboxylating] OS=Thermos... [more]
GCSP_RALME1.469e-8558.30Glycine dehydrogenase [decarboxylating] OS=Ralston... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-002-B11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659350 ID=EY659350|Name=EY659350|organism=Citrus sinensis|type=EST|length=862bp
AGCTTTTCTACTTTTCGCCGGGGGCAAATCAGTTCCATTCACTGCTGCAT
CTCTGGCTGAAGAGGTTGAGACTGCAATTCCGTCTGGATTAACAAGGGAG
AGTCCGTATCTGACAGATCCTGTTTTTAACAAATACCACACAGAGCATGA
ATTGCTTAGATACATTCATCTGTTACAATCAAAGGAGCTCTCACTATGCC
ATAGTATGATTCCATTGGGATCTTGTACAATGAAATTGAATGCAACAACT
GAAATGATGCCAGTGACATGGCCTAGCTTTGCTAACATACACCCTTTTGC
CCCTGCTGACCAGGCTCAGGGTTATCAGGAAATGTTTAACAATCTGGGTG
AGTGGCTGTGTACCATTACTGGCTTTGACTCTTTCTCTTTGCAACCAAAT
GCTGGTGCAGCTGGTGAGTATGCTGGGCTCATGGTTATCCGCGCTTATCA
TAAGGCAAGAGGAGACCATCACCGCAATGTGTGCATTATACCCGTGTCAG
CCCATGGGACAAATCCTGCTACTGCTGCCATGTGTGGAATGAAGATTGTT
TCTGTTGGAACTGATGCCAAGGGTAACATCAACATTGAAGAGTTAAGGAA
GGCCGCAGAAGCTAATAGGGACAACCTATCAACCCTTATGGTAACGTACC
CTTCAACTCATGGAGTTTATGAAGAAGGTATTGATGAGATATGCAAGATA
ATTCACGATAATGGAGGTCAAGTATATATGGACGGGGCTAACATGAATGC
TCANGGTCGTCTGACAGCCCTGGNTACATTGGAGCTGATGTTTGCATCTC
ATCTCCACAACATTTGCATTCGCATGGAGTGGNTGTCCCTGTATGGGCCT
ATTGTGTGAAGA
back to top