EY659350

Overview
NameEY659350
Unique NameEY659350
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length862
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12632 contig Csv1_Contig12632:598..1460. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659350 vs. ExPASy Swiss-Prot
Match: GCSP_RALSO (Glycine dehydrogenase [decarboxylating] OS=Ralstonia solanacearum GN=gcvP PE=3 SV=1)

HSP 1 Score: 314.309 bits (804), Expect = 5.582e-85
Identity = 140/229 (61.14%), Postives = 181/229 (79.04%), Query Frame = 2
Query:   65 VETAIPSGLTRESPYLTDPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNA 751
            +  A P+ L R+S YLT PVFN +H+EHE+LRY+  L  K+L+L  +MIPLGSCTMKLNAT EM+PVTWP FANIHPFAPADQ  GY+EM + L + LC  TG+ + SLQPNAG+ GEYAGL++I AYH +RG+ HR+VC+IP SAHGTNPA+A M GMK+V V  D +GN+++ +L K A  +  NL+ +M+TYPSTHGV+EEG+  +C+I+H +GGQVY+DGANMNA
Sbjct:  480 IADAFPASLARQSAYLTHPVFNAHHSEHEMLRYLRSLADKDLALDRTMIPLGSCTMKLNATAEMLPVTWPEFANIHPFAPADQTVGYREMIDQLEQMLCAATGYAAVSLQPNAGSQGEYAGLLIIHAYHASRGESHRDVCLIPSSAHGTNPASAQMAGMKVVVVACDERGNVDLADLEKKAAEHSANLAAIMITYPSTHGVFEEGVKRVCEIVHSHGGQVYVDGANMNA 708          
BLAST of EY659350 vs. ExPASy Swiss-Prot
Match: GCSP1_PSEPK (Glycine dehydrogenase [decarboxylating] 1 OS=Pseudomonas putida (strain KT2440) GN=gcvP1 PE=3 SV=1)

HSP 1 Score: 313.923 bits (803), Expect = 7.290e-85
Identity = 146/250 (58.40%), Postives = 188/250 (75.20%), Query Frame = 2
Query:   20 GGKSVPFTAASLAEEVETAIPSGLTRESPYLTDPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAXGRLTA 769
            GG+       +LA    + +P+ L R+S  L  PVFN+YH+E EL+RY+  L  K+L+L  SMIPLGSCTMKLNA +EM+PVTW  F N+HPFAPA+Q+QGY +M   L   LC  TG+D+ SLQPNAG+ GEYAGL+ IRAYH++RG+ HR++C+IP SAHGTNPATA M GM++V    DA+GN+++E+LR  A  +R+ L+ +M+TYPSTHGV+EE I EIC IIHDNGGQVY+DGANMNA   L A
Sbjct:  439 GGEQAQPDFTALAASTGSLLPAALLRQSAILEHPVFNRYHSETELMRYLRRLADKDLALDRSMIPLGSCTMKLNAASEMIPVTWAEFGNLHPFAPAEQSQGYLQMTTELEAMLCAATGYDAVSLQPNAGSQGEYAGLLAIRAYHRSRGEGHRDICLIPSSAHGTNPATAHMAGMRVVVTACDARGNVDVEDLRAKAIEHRERLAAIMITYPSTHGVFEEAIGEICAIIHDNGGQVYIDGANMNAMVGLCA 688          
BLAST of EY659350 vs. ExPASy Swiss-Prot
Match: GCSP_RALPJ (Glycine dehydrogenase [decarboxylating] OS=Ralstonia pickettii (strain 12J) GN=gcvP PE=3 SV=1)

HSP 1 Score: 313.538 bits (802), Expect = 9.522e-85
Identity = 140/229 (61.14%), Postives = 181/229 (79.04%), Query Frame = 2
Query:   65 VETAIPSGLTRESPYLTDPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNA 751
            V  A P+ L R+S YLT PVFN +H+EHE+LRY+  L  K+L+L  +MIPLGSCTMKLNAT EM+PVTWP F+NIHPFAPADQ  GY+EM + L + LC  TG+ + SLQPNAG+ GEYAGL++I AYH +RG+ HRNVC+IP SAHGTNPA+A M GM++V V  D +GN+++ +L K A  +  NL+ +M+TYPSTHGV+EEG+  +C+I+H +GGQVY+DGANMNA
Sbjct:  477 VADAYPASLVRQSAYLTHPVFNAHHSEHEMLRYLRSLADKDLALDRTMIPLGSCTMKLNATAEMLPVTWPEFSNIHPFAPADQTVGYREMIDQLEQMLCAATGYAAVSLQPNAGSQGEYAGLLIIHAYHASRGEAHRNVCLIPSSAHGTNPASAQMAGMQVVVVACDERGNVDLADLEKKAAEHSKNLAAIMITYPSTHGVFEEGVKRVCEIVHSHGGQVYVDGANMNA 705          
BLAST of EY659350 vs. ExPASy Swiss-Prot
Match: GCSP_DECAR (Glycine dehydrogenase [decarboxylating] OS=Dechloromonas aromatica (strain RCB) GN=gcvP PE=3 SV=1)

HSP 1 Score: 313.153 bits (801), Expect = 1.244e-84
Identity = 144/234 (61.54%), Postives = 181/234 (77.35%), Query Frame = 2
Query:   68 ETAIPSGLTRESPYLTDPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAXGRLTA 769
            ++A+P  L R    L  PVFN +HTEHE+LRY+  LQ+K+L+L HSMI LGSCTMKLNAT+EM+PVTWP F  IHPFAP DQA GY EM  +L EWL T+TGFD+  +QPN+GA GEYAGL+ I  +H +RG+ HRNVC+IP SAHGTNPATA M  MK+V V  D  GN+++ +L+  AE ++D+L+ LM+TYPSTHGV+EE I +IC I+H NGGQVYMDGAN+NA   LT+
Sbjct:  459 DSALPDSLIRSDAVLQHPVFNTHHTEHEMLRYLKSLQNKDLALDHSMISLGSCTMKLNATSEMIPVTWPEFGGIHPFAPRDQAVGYLEMITSLTEWLKTVTGFDAICMQPNSGAQGEYAGLVAIDRFHASRGEEHRNVCLIPKSAHGTNPATAQMANMKVVVVDCDENGNVDVADLKAKAEEHKDDLACLMITYPSTHGVFEEAIRDICAIVHANGGQVYMDGANLNAQVGLTS 692          
BLAST of EY659350 vs. ExPASy Swiss-Prot
Match: GCSP_LEPIN (Glycine dehydrogenase [decarboxylating] OS=Leptospira interrogans GN=gcvP PE=3 SV=1)

HSP 1 Score: 311.227 bits (796), Expect = 1.393e-84
Identity = 142/231 (61.47%), Postives = 181/231 (78.35%), Query Frame = 2
Query:   77 IPSGLTRESPYLTDPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAXGRLTA 769
            +P    R++ YLT PVF  +HTE ++LRYI  L+S++LSL  SMIPLGSCTMKLNATTEM PVTWP F  IHPFAPADQ +GY+ +F  L +WLC ITGF   SLQPNAG+ GEYAGL+ IR YH++R + +RNVC+IP+SAHGTNPA+AAM G ++V V  D  GN+++E+L+  AE ++ +L+ LM+TYPSTHGV+EE + EIC+I+H  GGQVYMDGANMNA   LT+
Sbjct:  468 VPDSFKRKTSYLTHPVFQSHHTETKMLRYIRKLESRDLSLTTSMIPLGSCTMKLNATTEMYPVTWPEFGAIHPFAPADQTKGYKIIFEQLEKWLCEITGFAGVSLQPNAGSQGEYAGLLAIRRYHESRNESYRNVCLIPISAHGTNPASAAMAGFQVVVVSCDPNGNVDLEDLKAKAEEHKKDLAALMITYPSTHGVFEESVKEICQIVHSCGGQVYMDGANMNAQVGLTS 698          

HSP 2 Score: 24.2534 bits (51), Expect = 1.393e-84
Identity = 12/20 (60.00%), Postives = 13/20 (65.00%), Query Frame = 1
Query:  766 SPGYIGADVCISSPQHLHSH 825
            SPG IGADVC     HL+ H
Sbjct:  698 SPGEIGADVC-----HLNLH 712          
BLAST of EY659350 vs. ExPASy Swiss-Prot
Match: GCSP_LEPIC (Glycine dehydrogenase [decarboxylating] OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni GN=gcvP PE=3 SV=1)

HSP 1 Score: 311.227 bits (796), Expect = 1.393e-84
Identity = 142/231 (61.47%), Postives = 181/231 (78.35%), Query Frame = 2
Query:   77 IPSGLTRESPYLTDPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAXGRLTA 769
            +P    R++ YLT PVF  +HTE ++LRYI  L+S++LSL  SMIPLGSCTMKLNATTEM PVTWP F  IHPFAPADQ +GY+ +F  L +WLC ITGF   SLQPNAG+ GEYAGL+ IR YH++R + +RNVC+IP+SAHGTNPA+AAM G ++V V  D  GN+++E+L+  AE ++ +L+ LM+TYPSTHGV+EE + EIC+I+H  GGQVYMDGANMNA   LT+
Sbjct:  468 VPDSFKRKTSYLTHPVFQSHHTETKMLRYIRKLESRDLSLTTSMIPLGSCTMKLNATTEMYPVTWPEFGAIHPFAPADQTKGYKIIFEQLEKWLCEITGFAGVSLQPNAGSQGEYAGLLAIRRYHESRNESYRNVCLIPISAHGTNPASAAMAGFQVVVVSCDPNGNVDLEDLKAKAEEHKKDLAALMITYPSTHGVFEESVKEICQIVHSCGGQVYMDGANMNAQVGLTS 698          

HSP 2 Score: 24.2534 bits (51), Expect = 1.393e-84
Identity = 12/20 (60.00%), Postives = 13/20 (65.00%), Query Frame = 1
Query:  766 SPGYIGADVCISSPQHLHSH 825
            SPG IGADVC     HL+ H
Sbjct:  698 SPGEIGADVC-----HLNLH 712          
BLAST of EY659350 vs. ExPASy Swiss-Prot
Match: GCSP_VIBHB (Glycine dehydrogenase [decarboxylating] OS=Vibrio harveyi (strain ATCC BAA-1116 / BB120) GN=gcvP PE=3 SV=1)

HSP 1 Score: 312.768 bits (800), Expect = 1.624e-84
Identity = 145/254 (57.09%), Postives = 191/254 (75.20%), Query Frame = 2
Query:    5 FLLFAGGKSVPFTAASLAEEVETAIPSGLTRESPYLTDPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAXGRLT 766
            F +F   + V   +  +A     AIP  L R + YLT PVFN +H+E +++RY+  L++K+ SL H MIPLGSCTMKLNA  EM+PVTWP F +IHPFAPADQA GY  +  +L E LC ITG+D+FSLQPN+GA+GEYAGL+ I+ YH++RG+ HRNVC+IP SAHGTNPATA+M  MK+V V  D +GNI++ +L    + ++DNLS++M+TYPSTHGVYEE + E+C+++H  GGQVY+DGANMNA   LT
Sbjct:  435 FAVFGVKEEVAALSTEIAGNEFAAIPEALRRTTEYLTHPVFNTHHSETQMMRYLKQLENKDFSLTHGMIPLGSCTMKLNAAAEMIPVTWPEFGSIHPFAPADQAAGYAALAKDLKEKLCEITGYDAFSLQPNSGASGEYAGLIAIQRYHESRGEGHRNVCLIPSSAHGTNPATASMVSMKVVVVKCDEEGNIDVTDLAAKIKKHKDNLSSIMITYPSTHGVYEEQVKEVCEMVHAAGGQVYLDGANMNAQVGLT 688          
BLAST of EY659350 vs. ExPASy Swiss-Prot
Match: GCSP_STRM5 (Glycine dehydrogenase [decarboxylating] OS=Stenotrophomonas maltophilia (strain R551-3) GN=gcvP PE=3 SV=1)

HSP 1 Score: 311.612 bits (797), Expect = 3.618e-84
Identity = 146/247 (59.11%), Postives = 189/247 (76.52%), Query Frame = 2
Query:   11 LFAGGKSVPFTAASLAEEVETAIPSGLTRESPYLTDPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNA 751
            +F     V    AS A+    A+P+GL R+S +LT PVFN +H+EHELLRY+  L  K+L++  +MIPLGSCTMKLNAT EM+PVTWP F+ IHP  PADQA GY+E+ ++L   L   TG+D+ SLQPN+GA GEYAGL+ IRAYH++RG+ HR++C+IP SAHGTNPA+A MCGMK+V   TDA GN+++E++R  AE   D L+ +M+TYPSTHGV+EE + EIC+IIH +GGQVY DGANMNA
Sbjct:  439 VFGASLDVDALDASTAD----ALPAGLLRQSEFLTHPVFNTHHSEHELLRYLRSLADKDLAMDRTMIPLGSCTMKLNATAEMIPVTWPEFSQIHPLVPADQALGYKELIDSLEAMLVECTGYDAVSLQPNSGAQGEYAGLLAIRAYHRSRGEDHRDICLIPDSAHGTNPASAQMCGMKVVVTKTDANGNVDVEDIRLNAEKYSDRLAAIMMTYPSTHGVFEEEVVEICEIIHKHGGQVYTDGANMNA 681          
BLAST of EY659350 vs. ExPASy Swiss-Prot
Match: GCSP_LEPBL (Glycine dehydrogenase [decarboxylating] OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=gcvP PE=3 SV=1)

HSP 1 Score: 309.686 bits (792), Expect = 4.033e-84
Identity = 142/231 (61.47%), Postives = 180/231 (77.92%), Query Frame = 2
Query:   77 IPSGLTRESPYLTDPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAXGRLTA 769
            I     R + YLT PVF  +HTE ++LRYI  L+S++LSL  SMIPLGSCTMKLNATTEM PVTWP F  IHPFAP++Q +GY+ +F  L +WLC ITGF   SLQPNAG+ GEYAGL+ IR YH++R + HRNVC+IP+SAHGTNPA+AAM G K+V V  D  GN+++E+L+  AE ++++L+ LM+TYPSTHGV+EE + EIC+I+H  GGQVYMDGANMNA   LT+
Sbjct:  468 ISDSFKRSTSYLTHPVFQSFHTETKMLRYIRKLESRDLSLTTSMIPLGSCTMKLNATTEMYPVTWPEFGAIHPFAPSEQTKGYKIIFEQLEKWLCEITGFAGVSLQPNAGSQGEYAGLLAIRRYHESRKETHRNVCLIPISAHGTNPASAAMAGFKVVVVSCDQNGNVDLEDLKIKAEEHKNDLAALMITYPSTHGVFEESVKEICQIVHSRGGQVYMDGANMNAQVGLTS 698          

HSP 2 Score: 24.2534 bits (51), Expect = 4.033e-84
Identity = 12/20 (60.00%), Postives = 13/20 (65.00%), Query Frame = 1
Query:  766 SPGYIGADVCISSPQHLHSH 825
            SPG IGADVC     HL+ H
Sbjct:  698 SPGEIGADVC-----HLNLH 712          
BLAST of EY659350 vs. ExPASy Swiss-Prot
Match: GCSP_LEPBJ (Glycine dehydrogenase [decarboxylating] OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=gcvP PE=3 SV=1)

HSP 1 Score: 309.686 bits (792), Expect = 4.033e-84
Identity = 142/231 (61.47%), Postives = 180/231 (77.92%), Query Frame = 2
Query:   77 IPSGLTRESPYLTDPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAXGRLTA 769
            I     R + YLT PVF  +HTE ++LRYI  L+S++LSL  SMIPLGSCTMKLNATTEM PVTWP F  IHPFAP++Q +GY+ +F  L +WLC ITGF   SLQPNAG+ GEYAGL+ IR YH++R + HRNVC+IP+SAHGTNPA+AAM G K+V V  D  GN+++E+L+  AE ++++L+ LM+TYPSTHGV+EE + EIC+I+H  GGQVYMDGANMNA   LT+
Sbjct:  468 ISDSFKRSTSYLTHPVFQSFHTETKMLRYIRKLESRDLSLTTSMIPLGSCTMKLNATTEMYPVTWPEFGAIHPFAPSEQTKGYKIIFEQLEKWLCEITGFAGVSLQPNAGSQGEYAGLLAIRRYHESRKETHRNVCLIPISAHGTNPASAAMAGFKVVVVSCDQNGNVDLEDLKIKAEEHKNDLAALMITYPSTHGVFEESVKEICQIVHSRGGQVYMDGANMNAQVGLTS 698          

HSP 2 Score: 24.2534 bits (51), Expect = 4.033e-84
Identity = 12/20 (60.00%), Postives = 13/20 (65.00%), Query Frame = 1
Query:  766 SPGYIGADVCISSPQHLHSH 825
            SPG IGADVC     HL+ H
Sbjct:  698 SPGEIGADVC-----HLNLH 712          
The following BLAST results are available for this feature:
BLAST of EY659350 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 368
Match NameE-valueIdentityDescription
GCSP_RALSO5.582e-8561.14Glycine dehydrogenase [decarboxylating] OS=Ralston... [more]
GCSP1_PSEPK7.290e-8558.40Glycine dehydrogenase [decarboxylating] 1 OS=Pseud... [more]
GCSP_RALPJ9.522e-8561.14Glycine dehydrogenase [decarboxylating] OS=Ralston... [more]
GCSP_DECAR1.244e-8461.54Glycine dehydrogenase [decarboxylating] OS=Dechlor... [more]
GCSP_LEPIN1.393e-8461.47Glycine dehydrogenase [decarboxylating] OS=Leptosp... [more]
GCSP_LEPIC1.393e-8461.47Glycine dehydrogenase [decarboxylating] OS=Leptosp... [more]
GCSP_VIBHB1.624e-8457.09Glycine dehydrogenase [decarboxylating] OS=Vibrio ... [more]
GCSP_STRM53.618e-8459.11Glycine dehydrogenase [decarboxylating] OS=Stenotr... [more]
GCSP_LEPBL4.033e-8461.47Glycine dehydrogenase [decarboxylating] OS=Leptosp... [more]
GCSP_LEPBJ4.033e-8461.47Glycine dehydrogenase [decarboxylating] OS=Leptosp... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-002-B11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659350 ID=EY659350|Name=EY659350|organism=Citrus sinensis|type=EST|length=862bp
AGCTTTTCTACTTTTCGCCGGGGGCAAATCAGTTCCATTCACTGCTGCAT
CTCTGGCTGAAGAGGTTGAGACTGCAATTCCGTCTGGATTAACAAGGGAG
AGTCCGTATCTGACAGATCCTGTTTTTAACAAATACCACACAGAGCATGA
ATTGCTTAGATACATTCATCTGTTACAATCAAAGGAGCTCTCACTATGCC
ATAGTATGATTCCATTGGGATCTTGTACAATGAAATTGAATGCAACAACT
GAAATGATGCCAGTGACATGGCCTAGCTTTGCTAACATACACCCTTTTGC
CCCTGCTGACCAGGCTCAGGGTTATCAGGAAATGTTTAACAATCTGGGTG
AGTGGCTGTGTACCATTACTGGCTTTGACTCTTTCTCTTTGCAACCAAAT
GCTGGTGCAGCTGGTGAGTATGCTGGGCTCATGGTTATCCGCGCTTATCA
TAAGGCAAGAGGAGACCATCACCGCAATGTGTGCATTATACCCGTGTCAG
CCCATGGGACAAATCCTGCTACTGCTGCCATGTGTGGAATGAAGATTGTT
TCTGTTGGAACTGATGCCAAGGGTAACATCAACATTGAAGAGTTAAGGAA
GGCCGCAGAAGCTAATAGGGACAACCTATCAACCCTTATGGTAACGTACC
CTTCAACTCATGGAGTTTATGAAGAAGGTATTGATGAGATATGCAAGATA
ATTCACGATAATGGAGGTCAAGTATATATGGACGGGGCTAACATGAATGC
TCANGGTCGTCTGACAGCCCTGGNTACATTGGAGCTGATGTTTGCATCTC
ATCTCCACAACATTTGCATTCGCATGGAGTGGNTGTCCCTGTATGGGCCT
ATTGTGTGAAGA
back to top