EY659350

Overview
NameEY659350
Unique NameEY659350
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length862
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12632 contig Csv1_Contig12632:598..1460. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659350 vs. ExPASy Swiss-Prot
Match: GCSP_BURM1 (Glycine dehydrogenase [decarboxylating] OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=gcvP PE=3 SV=1)

HSP 1 Score: 307.76 bits (787), Expect = 5.225e-83
Identity = 146/255 (57.25%), Postives = 189/255 (74.12%), Query Frame = 2
Query:    5 FLLFAGGKSVPFTAASLAEEVETAIPSGLTRESPYLTDPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAXGRLTA 769
            F   AGG +    A       E A+P+ L R S YLT  VFN++H+E E+LRY+  L  K+L+L  SMIPLGSCTMKLNAT+EM+PVTWP F  IHPFAPA+Q  GY+EM + L + L   TG+ + SLQPNAG+ GEYAGL++I AYH +RG+ HR+VC+IP SAHGTNPA+A M GMK+V V  DA+GN++I +L+  AE +  NL+ +M+TYPSTHGV+E+ + EIC+I+H +GGQVY+DGANMNA   LTA
Sbjct:  454 FAQAAGGTAPSVDALDAGLGGEAALPASLVRTSAYLTHHVFNRHHSETEMLRYLRSLSDKDLALDRSMIPLGSCTMKLNATSEMLPVTWPEFGRIHPFAPAEQTVGYREMIDQLEQMLVAATGYAAVSLQPNAGSQGEYAGLLIIHAYHASRGEGHRDVCLIPASAHGTNPASAHMAGMKVVVVACDAQGNVDIADLKAKAEQHSANLAAIMITYPSTHGVFEQNVREICEIVHAHGGQVYVDGANMNAMVGLTA 708          
BLAST of EY659350 vs. ExPASy Swiss-Prot
Match: GCSP_BURCC (Glycine dehydrogenase [decarboxylating] OS=Burkholderia cenocepacia (strain MC0-3) GN=gcvP PE=3 SV=1)

HSP 1 Score: 307.375 bits (786), Expect = 6.824e-83
Identity = 146/255 (57.25%), Postives = 189/255 (74.12%), Query Frame = 2
Query:    5 FLLFAGGKSVPFTAASLAEEVETAIPSGLTRESPYLTDPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAXGRLTA 769
            F   AGG +    A         A+P+GL R S YLT  VFN++H+E E+LRY+  L  K+L+L  SMIPLGSCTMKLNAT+EM+PVTWP F  IHPFAPA+Q  GY+EM + L + L   TG+ + SLQPNAG+ GEYAGL++I AYH +RG+ HR+VC+IP SAHGTNPA+A M GMK+V V  DA+GN++I +L+  AE +  NL+ +M+TYPSTHGV+E+ + EIC+I+H +GGQVY+DGANMNA   LTA
Sbjct:  454 FAQAAGGTAPAVDALDAGLAGVAALPAGLERTSAYLTHHVFNRHHSETEMLRYLRSLSDKDLALDRSMIPLGSCTMKLNATSEMLPVTWPEFGGIHPFAPAEQTVGYREMIDQLEQMLVAATGYAAVSLQPNAGSQGEYAGLLIIHAYHASRGEGHRDVCLIPASAHGTNPASAHMAGMKVVVVACDAQGNVDIADLKAKAEQHSANLAAIMITYPSTHGVFEQNVREICEIVHAHGGQVYVDGANMNAMVGLTA 708          
BLAST of EY659350 vs. ExPASy Swiss-Prot
Match: GCSP_BURA4 (Glycine dehydrogenase [decarboxylating] OS=Burkholderia ambifaria (strain MC40-6) GN=gcvP PE=3 SV=1)

HSP 1 Score: 307.375 bits (786), Expect = 6.824e-83
Identity = 145/255 (56.86%), Postives = 190/255 (74.51%), Query Frame = 2
Query:    5 FLLFAGGKSVPFTAASLAEEVETAIPSGLTRESPYLTDPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAXGRLTA 769
            F   AGG +    A         A+P+GL R S YLT  VFN++H+E E+LRY+  L  K+L+L  SMIPLGSCTMKLNAT+EM+PVTWP F  IHPFAPA+Q  GY+EM + L + L   TG+ + SLQPNAG+ GEYAGL++I AYH +RG+ HR+VC+IP SAHGTNPA+A M GMK+V V  DA+GN++I +L+  AE + ++L+ +M+TYPSTHGV+E+ + EIC+I+H +GGQVY+DGANMNA   LTA
Sbjct:  454 FAQAAGGTAPSVDALDAGAAGVAALPAGLERTSAYLTHHVFNRHHSETEMLRYLRSLSDKDLALDRSMIPLGSCTMKLNATSEMLPVTWPEFGRIHPFAPAEQTVGYREMIDQLEQMLVAATGYAAVSLQPNAGSQGEYAGLLIIHAYHASRGEAHRDVCLIPASAHGTNPASAHMAGMKVVVVACDAQGNVDIADLKAKAEQHANDLAAIMITYPSTHGVFEQNVREICEIVHAHGGQVYVDGANMNAMVGLTA 708          
BLAST of EY659350 vs. ExPASy Swiss-Prot
Match: GCSP_SHEFN (Glycine dehydrogenase [decarboxylating] OS=Shewanella frigidimarina (strain NCIMB 400) GN=gcvP PE=3 SV=1)

HSP 1 Score: 306.605 bits (784), Expect = 9.783e-83
Identity = 144/255 (56.47%), Postives = 187/255 (73.33%), Query Frame = 2
Query:    8 LLFAG-GKSVPFTAASLAEEVETAIPSGLTRESPYLTDPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAXGRLTA 769
            +L AG G  V    A +      +IP  L R+   LT P FN+Y +E E++RYI  L++K+L+L HSMI LGSCTMKLNA  EM+PV+WP FAN+HPF P DQAQGY ++ N L E+L  ITG+DS  +QPN+GA GEYAGL+ I+ YH++RGD HRN+C+IP SAHGTNPA+A + GMK+V    D +GN+++E+LR  A    D+LS +M+TYPSTHGVYEE I E+C+I+H  GGQVY+DGANMNA   LT+
Sbjct:  440 ILGAGHGLDVATFDADIVANGSQSIPDALVRQDAVLTHPTFNRYQSETEMMRYIKRLENKDLALNHSMISLGSCTMKLNAAVEMLPVSWPEFANMHPFCPLDQAQGYTQLINELSEFLVKITGYDSVCIQPNSGAQGEYAGLLAIKKYHESRGDAHRNICLIPQSAHGTNPASAQLAGMKVVVTACDKQGNVDLEDLRTKAAELADSLSCIMITYPSTHGVYEESIREVCEIVHQYGGQVYLDGANMNAQVGLTS 694          

HSP 2 Score: 22.7126 bits (47), Expect = 9.783e-83
Identity = 11/20 (55.00%), Postives = 13/20 (65.00%), Query Frame = 1
Query:  766 SPGYIGADVCISSPQHLHSH 825
            SPG+IGADV      HL+ H
Sbjct:  694 SPGFIGADV-----SHLNLH 708          
BLAST of EY659350 vs. ExPASy Swiss-Prot
Match: GCSP_BURCM (Glycine dehydrogenase [decarboxylating] OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=gcvP PE=3 SV=1)

HSP 1 Score: 306.605 bits (784), Expect = 1.164e-82
Identity = 145/255 (56.86%), Postives = 190/255 (74.51%), Query Frame = 2
Query:    5 FLLFAGGKSVPFTAASLAEEVETAIPSGLTRESPYLTDPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAXGRLTA 769
            F   AGG +    A         A+P+GL R S YLT  VFN++H+E E+LRY+  L  K+L+L  SMIPLGSCTMKLNAT+EM+PVTWP F  IHPFAPA+Q  GY+EM + L + L   TG+ + SLQPNAG+ GEYAGL++I AYH +RG+ HR+VC+IP SAHGTNPA+A M GMK+V V  DA+GN++I +L+  AE + ++L+ +M+TYPSTHGV+E+ + EIC+I+H +GGQVY+DGANMNA   LTA
Sbjct:  454 FAQAAGGTAPSVDALDAGLAGVAALPAGLERTSAYLTHHVFNRHHSETEMLRYLRSLSDKDLALDRSMIPLGSCTMKLNATSEMLPVTWPEFGRIHPFAPAEQTVGYREMIDQLEQMLVAATGYAAVSLQPNAGSQGEYAGLLIIHAYHASRGEAHRDVCLIPASAHGTNPASAHMAGMKVVVVACDAQGNVDIADLKAKAEQHANDLAAIMITYPSTHGVFEQNVREICEIVHAHGGQVYVDGANMNAMVGLTA 708          
BLAST of EY659350 vs. ExPASy Swiss-Prot
Match: GCSP1_PSEAE (Glycine dehydrogenase [decarboxylating] 1 OS=Pseudomonas aeruginosa GN=gcvP1 PE=3 SV=1)

HSP 1 Score: 306.605 bits (784), Expect = 1.164e-82
Identity = 144/254 (56.69%), Postives = 195/254 (76.77%), Query Frame = 2
Query:    8 LLFAGGKSVPFTAASLAEEVETAIPSGLTRESPYLTDPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAXGRLTA 769
            LL   G+++P  AA LA      +P  L R+S  L+ P+FN++H+E EL+RY+  L  K+L+L  +MIPLGSCTMKLNA +EM+PVTW  F N+HPFAPA+Q++GY+++ + L   LC+ TG+D+ SLQPNAG+ GEYAGL+ IRAYH++RGD  R++C+IP SAHGTNPATA+M GM++V V  DA+GN+++E+LR  A  +++ L+ LM+TYPSTHGV+EE I EIC I+HD GGQVY+DGANMNA   L A
Sbjct:  444 LLAEEGQALPDFAA-LAASSGDRLPVELLRQSAILSHPIFNRHHSETELMRYLRKLADKDLALDRTMIPLGSCTMKLNAASEMIPVTWAEFGNLHPFAPAEQSEGYRQLTDELEAMLCSATGYDAVSLQPNAGSQGEYAGLLAIRAYHQSRGDSQRDICLIPSSAHGTNPATASMVGMRVVVVACDARGNVDVEDLRNKASEHKERLAALMITYPSTHGVFEEAIREICAIVHDCGGQVYIDGANMNAMVGLCA 696          
BLAST of EY659350 vs. ExPASy Swiss-Prot
Match: GCSP_BURVG (Glycine dehydrogenase [decarboxylating] OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=gcvP PE=3 SV=1)

HSP 1 Score: 306.22 bits (783), Expect = 1.520e-82
Identity = 145/255 (56.86%), Postives = 190/255 (74.51%), Query Frame = 2
Query:    5 FLLFAGGKSVPFTAASLAEEVETAIPSGLTRESPYLTDPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAXGRLTA 769
            F   AGG +    A         A+P+GL R S YLT  VFN++H+E E+LRY+  L  K+L+L  SMIPLGSCTMKLNAT+EM+PVTWP F  IHPFAP++Q  GY+EM + L + L   TG+ + SLQPNAG+ GEYAGL+VI AYH +RG+ HR+VC+IP SAHGTNPA+A M GMK+V V  DA+GN++I +L+  AE + ++L+ +M+TYPSTHGV+E+ + EIC+I+H +GGQVY+DGANMNA   LTA
Sbjct:  454 FAQAAGGTAPDVDALDAGLPGVAALPAGLERTSAYLTHHVFNRHHSETEMLRYLRSLSDKDLALDRSMIPLGSCTMKLNATSEMLPVTWPEFGRIHPFAPSEQTAGYREMIDQLEQMLVAATGYAAVSLQPNAGSQGEYAGLLVIHAYHASRGEAHRDVCLIPASAHGTNPASAHMAGMKVVVVACDAQGNVDIADLKAKAEQHANDLAAIMITYPSTHGVFEQNVREICEIVHAHGGQVYVDGANMNAMVGLTA 708          
BLAST of EY659350 vs. ExPASy Swiss-Prot
Match: GCSP_BURCJ (Glycine dehydrogenase [decarboxylating] OS=Burkholderia cepacia (strain J2315 / LMG 16656) GN=gcvP PE=3 SV=1)

HSP 1 Score: 305.834 bits (782), Expect = 1.985e-82
Identity = 145/255 (56.86%), Postives = 189/255 (74.12%), Query Frame = 2
Query:    5 FLLFAGGKSVPFTAASLAEEVETAIPSGLTRESPYLTDPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAXGRLTA 769
            F   AGG +    A         A+P+GL R S YLT  VFN++H+E E+LRY+  L  K+L+L  SMIPLGSCTMKLNAT+EM+PVTWP F  IHPFAPA+Q  GY+EM + L + L   TG+ + SLQPNAG+ GEYAGL++I AYH +RG+ HR+VC+IP SAHGTNPA+A M GMK+V V  DA+GN++I +L+  AE +  +L+ +M+TYPSTHGV+E+ + EIC+I+H +GGQVY+DGANMNA   LTA
Sbjct:  454 FAQAAGGTAPAVDALDAGLAGVAALPAGLERTSAYLTHHVFNRHHSETEMLRYLRSLSDKDLALDRSMIPLGSCTMKLNATSEMLPVTWPEFGRIHPFAPAEQTVGYREMIDQLEQMLVAATGYAAVSLQPNAGSQGEYAGLLIIHAYHASRGEGHRDVCLIPASAHGTNPASAHMAGMKVVVVACDAQGNVDIADLKAKAEQHSKDLAAIMITYPSTHGVFEQNVREICEIVHAHGGQVYVDGANMNAMVGLTA 708          
BLAST of EY659350 vs. ExPASy Swiss-Prot
Match: GCSP_CITK8 (Glycine dehydrogenase [decarboxylating] OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=gcvP PE=3 SV=1)

HSP 1 Score: 305.449 bits (781), Expect = 2.171e-82
Identity = 136/232 (58.62%), Postives = 179/232 (77.16%), Query Frame = 2
Query:   74 AIPSGLTRESPYLTDPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAXGRLTA 769
            +I   + R+   LT PVFN+YH+E E++RY+H L+ K+L+L  +MIPLGSCTMKLNA  EM+P+TWP FA +HPF PA+QA+GY +M N L +WL  +TG+D+  +QPN+GA GEYAGL+ IR YH++R D HR++C+IP SAHGTNPA+A M GM++V V  D  GNI++ +LR  AE   DNLS +MVTYPSTHGVYEE I E+C+I+H  GGQVY+DGANMNA   +T+
Sbjct:  462 SIQESMLRDDAILTHPVFNRYHSETEMMRYMHSLERKDLALNQAMIPLGSCTMKLNAAAEMIPITWPEFAELHPFCPAEQAEGYHQMINQLSDWLVKLTGYDAVCMQPNSGAQGEYAGLLAIRHYHESRNDGHRDICLIPASAHGTNPASAQMAGMQVVVVACDKNGNIDLADLRAKAEQAGDNLSCIMVTYPSTHGVYEETIREVCEIVHQFGGQVYLDGANMNAQVGITS 693          

HSP 2 Score: 22.7126 bits (47), Expect = 2.171e-82
Identity = 11/20 (55.00%), Postives = 13/20 (65.00%), Query Frame = 1
Query:  766 SPGYIGADVCISSPQHLHSH 825
            SPG+IGADV      HL+ H
Sbjct:  693 SPGFIGADV-----SHLNLH 707          
BLAST of EY659350 vs. ExPASy Swiss-Prot
Match: GCSP_PSEU5 (Glycine dehydrogenase [decarboxylating] OS=Pseudomonas stutzeri (strain A1501) GN=gcvP PE=3 SV=1)

HSP 1 Score: 305.449 bits (781), Expect = 2.593e-82
Identity = 148/248 (59.68%), Postives = 186/248 (75.00%), Query Frame = 2
Query:   11 LFAGGKSVPFTAASLAEEVETAIPSGLTRESPYLTDPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEEL-RKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNA 751
            +F G       AA  A E+   IP+GL R+S YL  PVFN +H+E E+LRY+  L++K+L+L  +MIPLGSCTMKLNAT+EM+P+TW  FAN+HPF P  QAQGY+ M   L  WLC ITGFD+ S+QPN+GA GEYAGL+ IR YH++RG+  R++C+IP SAHGTNPA+A M  M++V V  D  GN+++E+L RKAAEA  D LS LM+TYPSTHGVYEE + EIC  IH  GGQVYMDGAN+NA
Sbjct:  440 IFLGADHGLDVAALDAGELAAGIPAGLQRDSGYLEHPVFNSHHSETEMLRYLKQLENKDLALNQAMIPLGSCTMKLNATSEMIPITWAEFANLHPFVPRGQAQGYRLMIEELEAWLCAITGFDAISMQPNSGAQGEYAGLVAIRKYHESRGEGQRDICLIPSSAHGTNPASAQMVSMRVVIVECDKGGNVDLEDLKRKAAEAG-DRLSCLMITYPSTHGVYEENVREICAAIHAQGGQVYMDGANLNA 686          
The following BLAST results are available for this feature:
BLAST of EY659350 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 368
Match NameE-valueIdentityDescription
GCSP_BURM15.225e-8357.25Glycine dehydrogenase [decarboxylating] OS=Burkhol... [more]
GCSP_BURCC6.824e-8357.25Glycine dehydrogenase [decarboxylating] OS=Burkhol... [more]
GCSP_BURA46.824e-8356.86Glycine dehydrogenase [decarboxylating] OS=Burkhol... [more]
GCSP_SHEFN9.783e-8356.47Glycine dehydrogenase [decarboxylating] OS=Shewane... [more]
GCSP_BURCM1.164e-8256.86Glycine dehydrogenase [decarboxylating] OS=Burkhol... [more]
GCSP1_PSEAE1.164e-8256.69Glycine dehydrogenase [decarboxylating] 1 OS=Pseud... [more]
GCSP_BURVG1.520e-8256.86Glycine dehydrogenase [decarboxylating] OS=Burkhol... [more]
GCSP_BURCJ1.985e-8256.86Glycine dehydrogenase [decarboxylating] OS=Burkhol... [more]
GCSP_CITK82.171e-8258.62Glycine dehydrogenase [decarboxylating] OS=Citroba... [more]
GCSP_PSEU52.593e-8259.68Glycine dehydrogenase [decarboxylating] OS=Pseudom... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-002-B11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659350 ID=EY659350|Name=EY659350|organism=Citrus sinensis|type=EST|length=862bp
AGCTTTTCTACTTTTCGCCGGGGGCAAATCAGTTCCATTCACTGCTGCAT
CTCTGGCTGAAGAGGTTGAGACTGCAATTCCGTCTGGATTAACAAGGGAG
AGTCCGTATCTGACAGATCCTGTTTTTAACAAATACCACACAGAGCATGA
ATTGCTTAGATACATTCATCTGTTACAATCAAAGGAGCTCTCACTATGCC
ATAGTATGATTCCATTGGGATCTTGTACAATGAAATTGAATGCAACAACT
GAAATGATGCCAGTGACATGGCCTAGCTTTGCTAACATACACCCTTTTGC
CCCTGCTGACCAGGCTCAGGGTTATCAGGAAATGTTTAACAATCTGGGTG
AGTGGCTGTGTACCATTACTGGCTTTGACTCTTTCTCTTTGCAACCAAAT
GCTGGTGCAGCTGGTGAGTATGCTGGGCTCATGGTTATCCGCGCTTATCA
TAAGGCAAGAGGAGACCATCACCGCAATGTGTGCATTATACCCGTGTCAG
CCCATGGGACAAATCCTGCTACTGCTGCCATGTGTGGAATGAAGATTGTT
TCTGTTGGAACTGATGCCAAGGGTAACATCAACATTGAAGAGTTAAGGAA
GGCCGCAGAAGCTAATAGGGACAACCTATCAACCCTTATGGTAACGTACC
CTTCAACTCATGGAGTTTATGAAGAAGGTATTGATGAGATATGCAAGATA
ATTCACGATAATGGAGGTCAAGTATATATGGACGGGGCTAACATGAATGC
TCANGGTCGTCTGACAGCCCTGGNTACATTGGAGCTGATGTTTGCATCTC
ATCTCCACAACATTTGCATTCGCATGGAGTGGNTGTCCCTGTATGGGCCT
ATTGTGTGAAGA
back to top