EY659350

Overview
NameEY659350
Unique NameEY659350
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length862
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12632 contig Csv1_Contig12632:598..1460. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659350 vs. ExPASy Swiss-Prot
Match: GCSP_NITHX (Glycine dehydrogenase [decarboxylating] OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=gcvP PE=3 SV=1)

HSP 1 Score: 302.753 bits (774), Expect = 1.681e-81
Identity = 137/238 (57.56%), Postives = 181/238 (76.05%), Query Frame = 2
Query:   38 FTAASLAEEVETAIPSGLTRESPYLTDPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNA 751
            F+ A +       +P+ L R + YLT PVF+ + +E ELLRY+  L  ++L+L  +MIPLGSCTMKLNATTEM+P+TWP+FA +HPFAP +QA+GY  +F    +WL  ITG+D+ SLQPN+GA GEYAGL+ IR YH ARGD HR VC+IP SAHGTNPA+A M GM++V V  DA+G++++++LR  A  + D L+ +M+TYPSTHGV+EE I EIC I+H +GGQVY+DGANMNA
Sbjct:  445 FSYADVEAHAPDLLPADLGRRTAYLTHPVFHAHRSETELLRYMRKLSDRDLALDRAMIPLGSCTMKLNATTEMIPLTWPAFAGLHPFAPCEQAEGYYALFEEFEQWLIDITGYDAISLQPNSGAQGEYAGLLAIRGYHAARGDSHRTVCLIPSSAHGTNPASANMAGMEVVVVACDARGDVDVDDLRAKAAQHADRLAAIMITYPSTHGVFEERIREICDIVHSHGGQVYLDGANMNA 682          
BLAST of EY659350 vs. ExPASy Swiss-Prot
Match: GCSP_BURPS (Glycine dehydrogenase [decarboxylating] OS=Burkholderia pseudomallei GN=gcvP PE=3 SV=1)

HSP 1 Score: 302.753 bits (774), Expect = 1.681e-81
Identity = 139/232 (59.91%), Postives = 183/232 (78.88%), Query Frame = 2
Query:   74 AIPSGLTRESPYLTDPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAXGRLTA 769
            A+P  L R S YLT  VFN++H+E E+LRY+  L  K+L+L  SMIPLGSCTMKLNAT+EM+PVTWP F  IHPFAPA+Q  GY+EM + L + L   TG+ + SLQPNAG+ GEYAGL++I AYH++RG+ HR+VC+IP SAHGTNPA+A M GMK+V V  DA+GN++I +L+  A+A+  +L+ +M+TYPSTHGV+E+ + EIC+I+H +GGQVY+DGANMNA   LTA
Sbjct:  477 ALPPSLERTSAYLTHHVFNRHHSETEMLRYLRSLSDKDLALDRSMIPLGSCTMKLNATSEMLPVTWPEFGRIHPFAPAEQTVGYREMIDQLEQMLVAATGYAAVSLQPNAGSQGEYAGLLIIHAYHESRGESHRDVCLIPASAHGTNPASAHMAGMKVVVVACDAQGNVDIADLKAKADAHSHDLAAIMITYPSTHGVFEQNVREICEIVHAHGGQVYVDGANMNAMVGLTA 708          
BLAST of EY659350 vs. ExPASy Swiss-Prot
Match: GCSP_BURP6 (Glycine dehydrogenase [decarboxylating] OS=Burkholderia pseudomallei (strain 668) GN=gcvP PE=3 SV=1)

HSP 1 Score: 302.753 bits (774), Expect = 1.681e-81
Identity = 139/232 (59.91%), Postives = 183/232 (78.88%), Query Frame = 2
Query:   74 AIPSGLTRESPYLTDPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAXGRLTA 769
            A+P  L R S YLT  VFN++H+E E+LRY+  L  K+L+L  SMIPLGSCTMKLNAT+EM+PVTWP F  IHPFAPA+Q  GY+EM + L + L   TG+ + SLQPNAG+ GEYAGL++I AYH++RG+ HR+VC+IP SAHGTNPA+A M GMK+V V  DA+GN++I +L+  A+A+  +L+ +M+TYPSTHGV+E+ + EIC+I+H +GGQVY+DGANMNA   LTA
Sbjct:  477 ALPPSLERTSAYLTHHVFNRHHSETEMLRYLRSLSDKDLALDRSMIPLGSCTMKLNATSEMLPVTWPEFGRIHPFAPAEQTVGYREMIDQLEQMLVAATGYAAVSLQPNAGSQGEYAGLLIIHAYHESRGESHRDVCLIPASAHGTNPASAHMAGMKVVVVACDAQGNVDIADLKAKADAHSHDLAAIMITYPSTHGVFEQNVREICEIVHAHGGQVYVDGANMNAMVGLTA 708          
BLAST of EY659350 vs. ExPASy Swiss-Prot
Match: GCSP_BURP1 (Glycine dehydrogenase [decarboxylating] OS=Burkholderia pseudomallei (strain 1710b) GN=gcvP PE=3 SV=1)

HSP 1 Score: 302.753 bits (774), Expect = 1.681e-81
Identity = 139/232 (59.91%), Postives = 183/232 (78.88%), Query Frame = 2
Query:   74 AIPSGLTRESPYLTDPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAXGRLTA 769
            A+P  L R S YLT  VFN++H+E E+LRY+  L  K+L+L  SMIPLGSCTMKLNAT+EM+PVTWP F  IHPFAPA+Q  GY+EM + L + L   TG+ + SLQPNAG+ GEYAGL++I AYH++RG+ HR+VC+IP SAHGTNPA+A M GMK+V V  DA+GN++I +L+  A+A+  +L+ +M+TYPSTHGV+E+ + EIC+I+H +GGQVY+DGANMNA   LTA
Sbjct:  477 ALPPSLERTSAYLTHHVFNRHHSETEMLRYLRSLSDKDLALDRSMIPLGSCTMKLNATSEMLPVTWPEFGRIHPFAPAEQTVGYREMIDQLEQMLVAATGYAAVSLQPNAGSQGEYAGLLIIHAYHESRGESHRDVCLIPASAHGTNPASAHMAGMKVVVVACDAQGNVDIADLKAKADAHSHDLAAIMITYPSTHGVFEQNVREICEIVHAHGGQVYVDGANMNAMVGLTA 708          
BLAST of EY659350 vs. ExPASy Swiss-Prot
Match: GCSP_BURP0 (Glycine dehydrogenase [decarboxylating] OS=Burkholderia pseudomallei (strain 1106a) GN=gcvP PE=3 SV=1)

HSP 1 Score: 302.753 bits (774), Expect = 1.681e-81
Identity = 139/232 (59.91%), Postives = 183/232 (78.88%), Query Frame = 2
Query:   74 AIPSGLTRESPYLTDPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAXGRLTA 769
            A+P  L R S YLT  VFN++H+E E+LRY+  L  K+L+L  SMIPLGSCTMKLNAT+EM+PVTWP F  IHPFAPA+Q  GY+EM + L + L   TG+ + SLQPNAG+ GEYAGL++I AYH++RG+ HR+VC+IP SAHGTNPA+A M GMK+V V  DA+GN++I +L+  A+A+  +L+ +M+TYPSTHGV+E+ + EIC+I+H +GGQVY+DGANMNA   LTA
Sbjct:  477 ALPPSLERTSAYLTHHVFNRHHSETEMLRYLRSLSDKDLALDRSMIPLGSCTMKLNATSEMLPVTWPEFGRIHPFAPAEQTVGYREMIDQLEQMLVAATGYAAVSLQPNAGSQGEYAGLLIIHAYHESRGESHRDVCLIPASAHGTNPASAHMAGMKVVVVACDAQGNVDIADLKAKADAHSHDLAAIMITYPSTHGVFEQNVREICEIVHAHGGQVYVDGANMNAMVGLTA 708          
BLAST of EY659350 vs. ExPASy Swiss-Prot
Match: GCSP_BURMS (Glycine dehydrogenase [decarboxylating] OS=Burkholderia mallei (strain SAVP1) GN=gcvP PE=3 SV=1)

HSP 1 Score: 302.753 bits (774), Expect = 1.681e-81
Identity = 139/232 (59.91%), Postives = 183/232 (78.88%), Query Frame = 2
Query:   74 AIPSGLTRESPYLTDPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAXGRLTA 769
            A+P  L R S YLT  VFN++H+E E+LRY+  L  K+L+L  SMIPLGSCTMKLNAT+EM+PVTWP F  IHPFAPA+Q  GY+EM + L + L   TG+ + SLQPNAG+ GEYAGL++I AYH++RG+ HR+VC+IP SAHGTNPA+A M GMK+V V  DA+GN++I +L+  A+A+  +L+ +M+TYPSTHGV+E+ + EIC+I+H +GGQVY+DGANMNA   LTA
Sbjct:  477 ALPPSLERTSAYLTHHVFNRHHSETEMLRYLRSLSDKDLALDRSMIPLGSCTMKLNATSEMLPVTWPEFGRIHPFAPAEQTVGYREMIDQLEQMLVAATGYAAVSLQPNAGSQGEYAGLLIIHAYHESRGESHRDVCLIPASAHGTNPASAHMAGMKVVVVACDAQGNVDIADLKAKADAHSHDLAAIMITYPSTHGVFEQNVREICEIVHAHGGQVYVDGANMNAMVGLTA 708          
BLAST of EY659350 vs. ExPASy Swiss-Prot
Match: GCSP_BURMA (Glycine dehydrogenase [decarboxylating] OS=Burkholderia mallei GN=gcvP PE=3 SV=1)

HSP 1 Score: 302.753 bits (774), Expect = 1.681e-81
Identity = 139/232 (59.91%), Postives = 183/232 (78.88%), Query Frame = 2
Query:   74 AIPSGLTRESPYLTDPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAXGRLTA 769
            A+P  L R S YLT  VFN++H+E E+LRY+  L  K+L+L  SMIPLGSCTMKLNAT+EM+PVTWP F  IHPFAPA+Q  GY+EM + L + L   TG+ + SLQPNAG+ GEYAGL++I AYH++RG+ HR+VC+IP SAHGTNPA+A M GMK+V V  DA+GN++I +L+  A+A+  +L+ +M+TYPSTHGV+E+ + EIC+I+H +GGQVY+DGANMNA   LTA
Sbjct:  477 ALPPSLERTSAYLTHHVFNRHHSETEMLRYLRSLSDKDLALDRSMIPLGSCTMKLNATSEMLPVTWPEFGRIHPFAPAEQTVGYREMIDQLEQMLVAATGYAAVSLQPNAGSQGEYAGLLIIHAYHESRGESHRDVCLIPASAHGTNPASAHMAGMKVVVVACDAQGNVDIADLKAKADAHSHDLAAIMITYPSTHGVFEQNVREICEIVHAHGGQVYVDGANMNAMVGLTA 708          
BLAST of EY659350 vs. ExPASy Swiss-Prot
Match: GCSP_BURM9 (Glycine dehydrogenase [decarboxylating] OS=Burkholderia mallei (strain NCTC 10229) GN=gcvP PE=3 SV=1)

HSP 1 Score: 302.753 bits (774), Expect = 1.681e-81
Identity = 139/232 (59.91%), Postives = 183/232 (78.88%), Query Frame = 2
Query:   74 AIPSGLTRESPYLTDPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAXGRLTA 769
            A+P  L R S YLT  VFN++H+E E+LRY+  L  K+L+L  SMIPLGSCTMKLNAT+EM+PVTWP F  IHPFAPA+Q  GY+EM + L + L   TG+ + SLQPNAG+ GEYAGL++I AYH++RG+ HR+VC+IP SAHGTNPA+A M GMK+V V  DA+GN++I +L+  A+A+  +L+ +M+TYPSTHGV+E+ + EIC+I+H +GGQVY+DGANMNA   LTA
Sbjct:  477 ALPPSLERTSAYLTHHVFNRHHSETEMLRYLRSLSDKDLALDRSMIPLGSCTMKLNATSEMLPVTWPEFGRIHPFAPAEQTVGYREMIDQLEQMLVAATGYAAVSLQPNAGSQGEYAGLLIIHAYHESRGESHRDVCLIPASAHGTNPASAHMAGMKVVVVACDAQGNVDIADLKAKADAHSHDLAAIMITYPSTHGVFEQNVREICEIVHAHGGQVYVDGANMNAMVGLTA 708          
BLAST of EY659350 vs. ExPASy Swiss-Prot
Match: GCSP_BURM7 (Glycine dehydrogenase [decarboxylating] OS=Burkholderia mallei (strain NCTC 10247) GN=gcvP PE=3 SV=1)

HSP 1 Score: 302.753 bits (774), Expect = 1.681e-81
Identity = 139/232 (59.91%), Postives = 183/232 (78.88%), Query Frame = 2
Query:   74 AIPSGLTRESPYLTDPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAXGRLTA 769
            A+P  L R S YLT  VFN++H+E E+LRY+  L  K+L+L  SMIPLGSCTMKLNAT+EM+PVTWP F  IHPFAPA+Q  GY+EM + L + L   TG+ + SLQPNAG+ GEYAGL++I AYH++RG+ HR+VC+IP SAHGTNPA+A M GMK+V V  DA+GN++I +L+  A+A+  +L+ +M+TYPSTHGV+E+ + EIC+I+H +GGQVY+DGANMNA   LTA
Sbjct:  477 ALPPSLERTSAYLTHHVFNRHHSETEMLRYLRSLSDKDLALDRSMIPLGSCTMKLNATSEMLPVTWPEFGRIHPFAPAEQTVGYREMIDQLEQMLVAATGYAAVSLQPNAGSQGEYAGLLIIHAYHESRGESHRDVCLIPASAHGTNPASAHMAGMKVVVVACDAQGNVDIADLKAKADAHSHDLAAIMITYPSTHGVFEQNVREICEIVHAHGGQVYVDGANMNAMVGLTA 708          
BLAST of EY659350 vs. ExPASy Swiss-Prot
Match: GCSP_XYLFA (Glycine dehydrogenase [decarboxylating] OS=Xylella fastidiosa GN=gcvP PE=3 SV=1)

HSP 1 Score: 302.368 bits (773), Expect = 2.195e-81
Identity = 138/226 (61.06%), Postives = 178/226 (78.76%), Query Frame = 2
Query:   74 AIPSGLTRESPYLTDPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNA 751
            A+P+GL R S +LT PVFN +H+EHELLRY+ +L  K+L++  +MIPLGSCTMKLNAT EM+PVTW  FA IHP APA Q  GY+++ + L   L   TG+D+ SLQPN+GA GEYAGL+ IRAYH++RG+  RNVC+IP SAHGTNPA+A +CGM++V +  D  GN+++++LR  AE   D+L+ LMVTYPSTHGV+EE I EIC+I+H +GGQVY DGANMNA
Sbjct:  469 ALPAGLLRSSAFLTHPVFNTHHSEHELLRYLRMLADKDLAMDRTMIPLGSCTMKLNATAEMIPVTWQEFACIHPLAPAVQWSGYRQLIDELEAMLAECTGYDAISLQPNSGAQGEYAGLLAIRAYHRSRGEERRNVCLIPESAHGTNPASAQLCGMQVVIIKCDRSGNVDVDDLRMKAEKYSDSLAALMVTYPSTHGVFEEAITEICEIVHAHGGQVYTDGANMNA 694          
The following BLAST results are available for this feature:
BLAST of EY659350 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 368
Match NameE-valueIdentityDescription
GCSP_NITHX1.681e-8157.56Glycine dehydrogenase [decarboxylating] OS=Nitroba... [more]
GCSP_BURPS1.681e-8159.91Glycine dehydrogenase [decarboxylating] OS=Burkhol... [more]
GCSP_BURP61.681e-8159.91Glycine dehydrogenase [decarboxylating] OS=Burkhol... [more]
GCSP_BURP11.681e-8159.91Glycine dehydrogenase [decarboxylating] OS=Burkhol... [more]
GCSP_BURP01.681e-8159.91Glycine dehydrogenase [decarboxylating] OS=Burkhol... [more]
GCSP_BURMS1.681e-8159.91Glycine dehydrogenase [decarboxylating] OS=Burkhol... [more]
GCSP_BURMA1.681e-8159.91Glycine dehydrogenase [decarboxylating] OS=Burkhol... [more]
GCSP_BURM91.681e-8159.91Glycine dehydrogenase [decarboxylating] OS=Burkhol... [more]
GCSP_BURM71.681e-8159.91Glycine dehydrogenase [decarboxylating] OS=Burkhol... [more]
GCSP_XYLFA2.195e-8161.06Glycine dehydrogenase [decarboxylating] OS=Xylella... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-002-B11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659350 ID=EY659350|Name=EY659350|organism=Citrus sinensis|type=EST|length=862bp
AGCTTTTCTACTTTTCGCCGGGGGCAAATCAGTTCCATTCACTGCTGCAT
CTCTGGCTGAAGAGGTTGAGACTGCAATTCCGTCTGGATTAACAAGGGAG
AGTCCGTATCTGACAGATCCTGTTTTTAACAAATACCACACAGAGCATGA
ATTGCTTAGATACATTCATCTGTTACAATCAAAGGAGCTCTCACTATGCC
ATAGTATGATTCCATTGGGATCTTGTACAATGAAATTGAATGCAACAACT
GAAATGATGCCAGTGACATGGCCTAGCTTTGCTAACATACACCCTTTTGC
CCCTGCTGACCAGGCTCAGGGTTATCAGGAAATGTTTAACAATCTGGGTG
AGTGGCTGTGTACCATTACTGGCTTTGACTCTTTCTCTTTGCAACCAAAT
GCTGGTGCAGCTGGTGAGTATGCTGGGCTCATGGTTATCCGCGCTTATCA
TAAGGCAAGAGGAGACCATCACCGCAATGTGTGCATTATACCCGTGTCAG
CCCATGGGACAAATCCTGCTACTGCTGCCATGTGTGGAATGAAGATTGTT
TCTGTTGGAACTGATGCCAAGGGTAACATCAACATTGAAGAGTTAAGGAA
GGCCGCAGAAGCTAATAGGGACAACCTATCAACCCTTATGGTAACGTACC
CTTCAACTCATGGAGTTTATGAAGAAGGTATTGATGAGATATGCAAGATA
ATTCACGATAATGGAGGTCAAGTATATATGGACGGGGCTAACATGAATGC
TCANGGTCGTCTGACAGCCCTGGNTACATTGGAGCTGATGTTTGCATCTC
ATCTCCACAACATTTGCATTCGCATGGAGTGGNTGTCCCTGTATGGGCCT
ATTGTGTGAAGA
back to top