EY659349

Overview
NameEY659349
Unique NameEY659349
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length889
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7281 contig Csv1_Contig7281:583..1472. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACT3_LIMPO (Actin-3 OS=Limulus polyphemus PE=1 SV=1)

HSP 1 Score: 398.667 bits (1023), Expect = 2.356e-110
Identity = 192/220 (87.27%), Postives = 208/220 (94.55%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTTAEREIVRD+KEKL YVALD++QE+ TA SSSS+EK+YELPDGQ+ITIG ERFRCPE LFQPS +GME++GIHETTYNSIMKCD+DIRKDLY N VLSGG+TM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF
Sbjct:  157 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFDQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESSGIHETTYNSIMKCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACT_CRAGI (Actin OS=Crassostrea gigas PE=2 SV=1)

HSP 1 Score: 398.282 bits (1022), Expect = 3.077e-110
Identity = 192/220 (87.27%), Postives = 208/220 (94.55%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGVSHTVPIYEGYALPHAI+RLDLAGRDLTD LMKILTERGY FTTTAEREIVRD+KEKL YVALD+EQE+ TA SSSS+EK+YELPDGQ+ITIG ERFRCPE +FQPS +GME++GIHET+YNSIMKCDVDIRKDLY NIVLSGG+TMFPGIADRM KE+TALAP +MKIKV+APPERKYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF
Sbjct:  157 GDGVSHTVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMTTAASSSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESSGIHETSYNSIMKCDVDIRKDLYANIVLSGGTTMFPGIADRMQKEVTALAPPTMKIKVIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACTC_HELTI (Actin, cytoplasmic OS=Helisoma trivolvis PE=3 SV=1)

HSP 1 Score: 398.282 bits (1022), Expect = 3.077e-110
Identity = 191/220 (86.82%), Postives = 208/220 (94.55%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGV+HTVPIYEGYALPHAI+RLDLAGRDLTD LMKILTERGY FTTTAEREIVRD+KEKL YVALD+EQE++TA +SSS+EK+YELPDGQ+ITIG ERFRCPE ++QPS +GME+AGIHETTYNSIMKCDVDIRKDLY N VLSGGSTMFPGIADRM KEITALAP +MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF
Sbjct:  157 GDGVTHTVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMQTASTSSSLEKSYELPDGQVITIGNERFRCPEAMYQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACTB_ORYLA (Actin, cytoplasmic 1 OS=Oryzias latipes GN=actb PE=2 SV=2)

HSP 1 Score: 398.282 bits (1022), Expect = 3.077e-110
Identity = 193/220 (87.73%), Postives = 207/220 (94.09%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGV+HTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTTAEREIVRD+KEKL YVALD+EQE+ TA SSSS+EK+YELPDGQ+ITIG ERFRCPE LFQPS +GME+ GIHETTYNSIMKCDVDIRKDLY N VLSGG+TM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF
Sbjct:  156 GDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACTB_OREMO (Actin, cytoplasmic 1 OS=Oreochromis mossambicus GN=actb PE=2 SV=1)

HSP 1 Score: 398.282 bits (1022), Expect = 3.077e-110
Identity = 193/220 (87.73%), Postives = 207/220 (94.09%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGV+HTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTTAEREIVRD+KEKL YVALD+EQE+ TA SSSS+EK+YELPDGQ+ITIG ERFRCPE LFQPS +GME+ GIHETTYNSIMKCDVDIRKDLY N VLSGG+TM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF
Sbjct:  156 GDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACTB1_TAKRU (Actin, cytoplasmic 1 OS=Takifugu rubripes GN=actba PE=2 SV=1)

HSP 1 Score: 398.282 bits (1022), Expect = 3.077e-110
Identity = 193/220 (87.73%), Postives = 207/220 (94.09%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGV+HTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTTAEREIVRD+KEKL YVALD+EQE+ TA SSSS+EK+YELPDGQ+ITIG ERFRCPE LFQPS +GME+ GIHETTYNSIMKCDVDIRKDLY N VLSGG+TM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF
Sbjct:  156 GDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACT3_BOMMO (Actin, cytoplasmic A3 OS=Bombyx mori PE=3 SV=3)

HSP 1 Score: 398.282 bits (1022), Expect = 3.077e-110
Identity = 194/220 (88.18%), Postives = 206/220 (93.64%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTTAEREIVRD+KEKL YVALD+EQE+ TA SSSS+EK+YELPDGQ+ITIG ERFRCPE LFQPS +GMEA GIHETTYNSIMKCDVDIRKDLY N VLSGG+TM+PGIADRM KEIT LAPS+MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF
Sbjct:  157 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEANGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITRLAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACT2_SCHMA (Actin-2 OS=Schistosoma mansoni PE=2 SV=1)

HSP 1 Score: 398.282 bits (1022), Expect = 3.077e-110
Identity = 193/220 (87.73%), Postives = 207/220 (94.09%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGV+HTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTTAEREIVRD+KEKL YVALD+EQE+ TA SSSS+EK+YELPDGQ+ITIG ERFRCPE LFQPS +GME+AG+HETT+NSIMKCDVDIRKDLY N VLSGG+TMFPGIADRM KEITALAPS+MKIK+VAPPERKYSVWIGGSILASLSTFQQMWISK EYDESGP IVHRKCF
Sbjct:  157 GDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGVHETTFNSIMKCDVDIRKDLYANTVLSGGTTMFPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 376          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACTC_BIOPF (Actin, cytoplasmic OS=Biomphalaria pfeifferi PE=3 SV=1)

HSP 1 Score: 397.897 bits (1021), Expect = 4.019e-110
Identity = 192/220 (87.27%), Postives = 207/220 (94.09%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGV+HTVPIYEGYALPHAI+RLDLAGRDLTD LMKILTERGY FTTTAEREIVRD+KEKL YVALD+EQE+ TA +SSS+EK+YELPDGQ+ITIG ERFRCPE +FQPS +GME+AGIHETTYNSIMKCDVDIRKDLY N VLSGGSTMFPGIADRM KEITALAP +MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF
Sbjct:  157 GDGVTHTVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMHTAATSSSLEKSYELPDGQVITIGNERFRCPEAVFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of EY659349 vs. ExPASy Swiss-Prot
Match: ACT4_CAEEL (Actin-4 OS=Caenorhabditis elegans GN=act-4 PE=2 SV=2)

HSP 1 Score: 397.897 bits (1021), Expect = 4.019e-110
Identity = 191/220 (86.82%), Postives = 208/220 (94.55%), Query Frame = 3
Query:   12 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQIITIGAERFRCPEVLFQPSLIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 671
            GDGV+HTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY FTTTAEREIVRD+KEKL YVALD+EQE+ TA SSSS+EK+YELPDGQ+IT+G ERFRCPE LFQPS +GME+AGIHET+YNSIMKCD+DIRKDLY N VLSGG+TM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQMWISK EYDESGPSIVHRKCF
Sbjct:  157 GDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITVGNERFRCPEALFQPSFLGMESAGIHETSYNSIMKCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
The following BLAST results are available for this feature:
BLAST of EY659349 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 486
Match NameE-valueIdentityDescription
ACT3_LIMPO2.356e-11087.27Actin-3 OS=Limulus polyphemus PE=1 SV=1[more]
ACT_CRAGI3.077e-11087.27Actin OS=Crassostrea gigas PE=2 SV=1[more]
ACTC_HELTI3.077e-11086.82Actin, cytoplasmic OS=Helisoma trivolvis PE=3 SV=1[more]
ACTB_ORYLA3.077e-11087.73Actin, cytoplasmic 1 OS=Oryzias latipes GN=actb PE... [more]
ACTB_OREMO3.077e-11087.73Actin, cytoplasmic 1 OS=Oreochromis mossambicus GN... [more]
ACTB1_TAKRU3.077e-11087.73Actin, cytoplasmic 1 OS=Takifugu rubripes GN=actba... [more]
ACT3_BOMMO3.077e-11088.18Actin, cytoplasmic A3 OS=Bombyx mori PE=3 SV=3[more]
ACT2_SCHMA3.077e-11087.73Actin-2 OS=Schistosoma mansoni PE=2 SV=1[more]
ACTC_BIOPF4.019e-11087.27Actin, cytoplasmic OS=Biomphalaria pfeifferi PE=3 ... [more]
ACT4_CAEEL4.019e-11086.82Actin-4 OS=Caenorhabditis elegans GN=act-4 PE=2 SV... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-002-B10-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659349 ID=EY659349|Name=EY659349|organism=Citrus sinensis|type=EST|length=889bp
CCACGCGTCCGGGTGATGGTGTCTCTCATACTGTACCAATCTATGAGGGA
TATGCCCTTCCTCATGCCATTCTTCGTTTGGACTTGGCTGGTCGTGATCT
CACTGATGCATTGATGAAGATTCTTACTGAGAGAGGTTACATGTTTACCA
CCACAGCCGAACGGGAAATTGTCCGTGACATGAAGGAGAAGCTTGCTTAT
GTTGCCCTAGACTATGAGCAAGAACTTGAGACTGCCAAGAGCAGCTCATC
TGTTGAGAAGAACTATGAGCTGCCTGATGGCCAGATCATCACCATTGGAG
CTGAAAGATTCCGTTGCCCAGAAGTTCTGTTCCAGCCATCTCTCATCGGA
ATGGAAGCTGCTGGTATTCATGAGACTACCTACAACTCCATCATGAAGTG
TGATGTGGATATTAGAAAGGATCTGTATGGTAACATTGTTCTCAGTGGGG
GTTCAACTATGTTCCCTGGTATTGCCGACCGTATGAGCAAGGAAATCACA
GCACTTGCTCCAAGCAGCATGAAGATCAAGGTCGTGGCTCCACCAGAGAG
AAAATACAGTGTTTGGATTGGAGGATCAATCCTTGCATCCCTCAGCACCT
TCCAGCAGATGTGGATCTCAAAGGGCGAGTATGATGAGTCTGGTCCATCC
ATTGTCCACAGGAAATGCTTCTAAGTTCTTTAAGTGCTTGATGGGTGAGT
TCTTTTTTTCCATTTAGTTGGTTTTTTGTGTCTCGTTTCGCGAACTCAAG
TTGGTTGACATGGAGAAGTGCTAAGGATGGGGCCATTGAANGAGGCATAT
CTCGATATTTGATGTATTATACAGCTTCTTACAGCGTTTGAGGGGGGCTT
TATTCTGTACTCACCATCTTCCNTTGCTTGCATTCATCT
back to top