EY659338

Overview
NameEY659338
Unique NameEY659338
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length918
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: Y2165_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At2g16250 OS=Arabidopsis thaliana GN=At2g16250 PE=1 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 2.920e-18
Identity = 63/210 (30.00%), Postives = 98/210 (46.67%), Query Frame = 2
Query:  131 NCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            N  +L     +G  L G +P   G   ++L+ L + +CS++                        G +P T G L  L+ L L+ N L    P  L  L  L +L L  N  +G +P   S+L +L +L + SN  T  IP    +L  ++  +FSSN    P+ S++G+L  L+  +LS N+LSG +P  +  L  LQ+M +  N L G
Sbjct:  101 NLTRLSYFNASGLALPGTIPEWFGVSLLALEVLDLSSCSVN------------------------GVVPFTLGNLTSLRTLNLSQNSLTSLVPSSLGQLLNLSQLDLSRNSFTGVLPQSFSSLKNLLTLDVSSNYLTGPIPPGLGALSKLIHLNFSSNSFSSPIPSELGDLVNLVDFDLSINSLSGSVPQELRKLSKLQLMAIGDNLLSG 286          

HSP 2 Score: 81.6481 bits (200), Expect = 6.731e-15
Identity = 70/258 (27.13%), Postives = 103/258 (39.92%), Query Frame = 2
Query:   17 SGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLD-------------------------KLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDIL-FFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGG 712
            +G +P T+GNL +L  L L  N                    L  + L+ N   G+LP S  +L  +L TL + +  ++G IP  +G               + PIP+  G L  L    L+ N L GS P EL  L +L                           LVL  N  SGS+P    +L  LR L +  N FT ++P + +    I    D SSN   G L+  +   +++   +LS N   G +P  + G
Sbjct:  141 NGVVPFTLGNLTSLRTLNLSQN-----SLTSLVPSSLGQLLNLSQLDLSRNSFTGVLPQSFSSLK-NLLTLDVSSNYLTGPIPPGLGALSKLIHLNFSSNSFSSPIPSELGDLVNLVDFDLSINSLSGSVPQELRKLSKLQLMAIGDNLLSGTLPVDLFSAESQLQTLVLRENGFSGSLPDVCWSLPKLRILDIAKNNFTGLLPYSSYDSDQIAEMVDISSNTFYGELTPILRRFRIM---DLSGNYFEGKLPDYVTG 389          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: Y5374_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At5g37450 OS=Arabidopsis thaliana GN=At5g37450 PE=2 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 1.892e-17
Identity = 64/222 (28.83%), Postives = 105/222 (47.30%), Query Frame = 2
Query:  167 NPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYL-GSNRFTSVIPSTFWSLKDIL-----------------------FFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            N L G +P  +GNL+  +  L  GN  ++G++PQ +G               +G +PT+   L+KL+  ++  N + G  P E   L  +   ++  NKL+G++P  L+ + SLR L L GSN   + IPS++ S+ +++                       + D SSN L G +  +  +  +   INL  N LSG +P+   GL  LQ + +  N L G
Sbjct:  111 NDLTGQIPPELGNLTHLIFLLLSGN-QLTGSLPQELGSLSNLLILQIDYNEISGKLPTSLANLKKLKHFHMNNNSITGQIPPEYSTLTNVLHFLMDNNKLTGNLPPELAQMPSLRILQLDGSNFDGTEIPSSYGSIPNLVKLSLRNCNLEGPIPDLSKSLVLYYLDISSNKLTGEIPKNKFSANITT-INLYNNLLSGSIPSNFSGLPRLQRLQVQNNNLSG 330          

HSP 2 Score: 88.5817 bits (218), Expect = 5.506e-17
Identity = 55/185 (29.73%), Postives = 92/185 (49.73%), Query Frame = 2
Query:  212 MSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSG-DMPATIGGLKDLQIMDLAYNRLEGP 763
            + +K L + N +++G +   +G               TG IP   G L  L  L L+ N+L GS P EL  L  L  L +  N++SG +P+ L+NL  L+  ++ +N  T  IP  + +L ++L F   +N L G L  ++  +  L  + L  +N  G ++P++ G + +L  + L    LEGP
Sbjct:   77 LHVKELRLLNMNLTGQLAPELGLLSNLTILNFMWNDLTGQIPPELGNLTHLIFLLLSGNQLTGSLPQELGSLSNLLILQIDYNEISGKLPTSLANLKKLKHFHMNNNSITGQIPPEYSTLTNVLHFLMDNNKLTGNLPPELAQMPSLRILQLDGSNFDGTEIPSSYGSIPNLVKLSLRNCNLEGP 261          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: RPK2_ARATH (LRR receptor-like serine/threonine-protein kinase RPK2 OS=Arabidopsis thaliana GN=RPK2 PE=1 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 2.733e-16
Identity = 63/186 (33.87%), Postives = 87/186 (46.77%), Query Frame = 2
Query:  164 GNPLNGILPSSIGNLSMSLKTLYIGNC--SISGNIPQSIGXXXXXXXXXXXXXXXT-GPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCH-LGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIG 709
            GN L G  P ++ +    LK +Y+      +SG IPQ +                  GPIPT+ G L  L  L L++N+L G  P  L   +  L  L +  N L+G IP     L SL  L L SN  +  IP  F +LK++     ++N L GP+ S      V    N+S NNLSG +P+T G
Sbjct:  567 GNRLYGQFPGNLFDNCDELKAVYVNVSFNKLSGRIPQGLNNMCTSLKILDASVNQIFGPIPTSLGDLASLVALNLSWNQLQGQIPGSLGKKMAALTYLSIANNNLTGQIPQSFGQLHSLDVLDLSSNHLSGGIPHDFVNLKNLTVLLLNNNNLSGPIPSGFATFAVF---NVSSNNLSGPVPSTNG 749          

HSP 2 Score: 85.1149 bits (209), Expect = 6.088e-16
Identity = 80/259 (30.89%), Postives = 111/259 (42.86%), Query Frame = 2
Query:   11 AFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCH-LGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGN---LKVLLGINLSE-----NNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            A +G +P+ I +L  L  L L  N                  +KL  + L GN + G LP     L  +L+ + +G   +SG IP S+                 G +P   GR + L   +L  N L GS P ++    G+L+ L L GN L+G IP  L     LRSL L  N     IP  F SL+ +   D S N L GPL  ++GN   L VL+  NL       N++ G+     G   DL  M   +N  +G
Sbjct:  131 ALAGNLPSVIMSLTGLRVLSLPFNSFSGEIPVGIW-----GMEKLEVLDLEGNLMTGSLPDQFTGLR-NLRVMNLGFNRVSGEIPNSLQNLTKLEILNLGGNKLNGTVPGFVGRFRVL---HLPLNWLQGSLPKDIGDSCGKLEHLDLSGNFLTGRIPESLGKCAGLRSLLLYMNTLEETIPLEFGSLQKLEVLDVSRNTLSGPLPVELGNCSSLSVLVLSNLYNVYEDINSVRGEADLPPGA--DLTSMTEDFNFYQG 378          

HSP 3 Score: 85.1149 bits (209), Expect = 6.088e-16
Identity = 77/262 (29.39%), Postives = 108/262 (41.22%), Query Frame = 2
Query:   17 SGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFG--------NKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGPXLXXI 778
            SG IPN++ NL  LE L LG N                   + R + L  N L G LP  IG+    L+ L +    ++G IP+S+G                  IP  FG LQKL+ L ++ N L G  P EL +   L  LVL          N + G     L     L S+    N +   IP     L  +         L G    D G+ + L  +NL +N   G++P  +   K+L+++DL+ NRL G  L  I
Sbjct:  205 SGEIPNSLQNLTKLEILNLGGNKLNGTVPGFVG--------RFRVLHLPLNWLQGSLPKDIGDSCGKLEHLDLSGNFLTGRIPESLGKCAGLRSLLLYMNTLEETIPLEFGSLQKLEVLDVSRNTLSGPLPVELGNCSSLSVLVLSNLYNVYEDINSVRGEAD--LPPGADLTSMTEDFNFYQGGIPEEITRLPKLKILWVPRATLEGRFPGDWGSCQNLEMVNLGQNFFKGEIPVGLSKCKNLRLLDLSSNRLTGELLKEI 456          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: PSYR1_ARATH (Tyrosine-sulfated glycopeptide receptor 1 OS=Arabidopsis thaliana GN=PSYR1 PE=2 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 3.569e-16
Identity = 68/211 (32.23%), Postives = 99/211 (46.92%), Query Frame = 2
Query:  128 ANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSC-LSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSEN---NLSGDMPATIGGLKDLQIMDLAYN 748
            + C +L  +    N L+G +P  I NL   L+ L++    +SG I   I                 G IP   G+L KL  L L  N L+GS P  L +  +L KL L  N+L G++ +   S   SL  L LG+N FT   PST +S K +    F+ N L G +S  +  L+ L     S+N   NL+G + + + G K L  + +A N
Sbjct:  244 SRCSRLSVLRAGFNNLSGEIPKEIYNLP-ELEQLFLPVNRLSGKIDNGITRLTKLTLLELYSNHIEGEIPKDIGKLSKLSSLQLHVNNLMGSIPVSLANCTKLVKLNLRVNQLGGTLSAIDFSRFQSLSILDLGNNSFTGEFPSTVYSCKMMTAMRFAGNKLTGQISPQVLELESLSFFTFSDNKMTNLTGAL-SILQGCKKLSTLIMAKN 452          

HSP 2 Score: 80.1073 bits (196), Expect = 1.958e-14
Identity = 56/216 (25.93%), Postives = 93/216 (43.06%), Query Frame = 2
Query:  143 LRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSS-DIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGPXLXXIVTL 787
            L    ++ N   G +PS +   S  L  L       SG++ Q +                +G IP     L +L+ L+L  N+L G   + +  L +L  L L+ N + G IP  +  L+ L SL L  N     IP +  +   ++  +   N L G LS+ D    + L  ++L  N+ +G+ P+T+   K +  M  A N+L G     ++ L
Sbjct:  200 LTSFNVSNNSFTGSIPSFMCTASPQLTKLDFSYNDFSGDLSQELSRCSRLSVLRAGFNNLSGEIPKEIYNLPELEQLFLPVNRLSGKIDNGITRLTKLTLLELYSNHIEGEIPKDIGKLSKLSSLQLHVNNLMGSIPVSLANCTKLVKLNLRVNQLGGTLSAIDFSRFQSLSILDLGNNSFTGEFPSTVYSCKMMTAMRFAGNKLTGQISPQVLEL 415          

HSP 3 Score: 73.9442 bits (180), Expect = 1.403e-12
Identity = 59/210 (28.10%), Postives = 91/210 (43.33%), Query Frame = 2
Query:  143 LRDIGLTGNPLNGILPSSIGNL--SMSLKTLYIGNCSISGNIPQSI-GXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPA-TIGGLKDLQIMDLAYNRLEG 760
            ++ + L+ N L G + SS   L  + +L +  + N S +G+IP  +                 +G +     R  +L  L   FN L G  P E+ +L  L++L L  N+LSG I + ++ LT L  L L SN     IP     L  +       N L+G +   + N   L+ +NL  N L G + A      + L I+DL  N   G
Sbjct:  173 IQTVDLSSNLLEGEILSSSVFLQGAFNLTSFNVSNNSFTGSIPSFMCTASPQLTKLDFSYNDFSGDLSQELSRCSRLSVLRAGFNNLSGEIPKEIYNLPELEQLFLPVNRLSGKIDNGITRLTKLTLLELYSNHIEGEIPKDIGKLSKLSSLQLHVNNLMGSIPVSLANCTKLVKLNLRVNQLGGTLSAIDFSRFQSLSILDLGNNSFTG 382          

HSP 4 Score: 73.1738 bits (178), Expect = 2.394e-12
Identity = 69/257 (26.85%), Postives = 106/257 (41.25%), Query Frame = 2
Query:   17 SGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILP--SSIGNLS---MSLKTLYIGNCSISGNIPQS---IGXXXXXXXXXXXXXXXTGPIPTTFGRLQ-KLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            SG +P+++ +L+ L  L L +N               +   +L  + L+ N   G LP   S GN S     ++T+ + +  + G I  S   +                TG IP+       +L  L  ++N   G    EL    RL  L    N LSG IP  + NL  L  L+L  NR +  I +    L  +   +  SN + G +  DIG L  L  + L  NNL G +P ++     L  ++L  N+L G
Sbjct:  105 SGNLPSSVLDLQRLSRLDLSHN----RLSGPLPPGFLSALDQLLVLDLSYNSFKGELPLQQSFGNGSNGIFPIQTVDLSSNLLEGEILSSSVFLQGAFNLTSFNVSNNSFTGSIPSFMCTASPQLTKLDFSYNDFSGDLSQELSRCSRLSVLRAGFNNLSGEIPKEIYNLPELEQLFLPVNRLSGKIDNGITRLTKLTLLELYSNHIEGEIPKDIGKLSKLSSLQLHVNNLMGSIPVSLANCTKLVKLNLRVNQLGG 357          

HSP 5 Score: 73.1738 bits (178), Expect = 2.394e-12
Identity = 66/228 (28.95%), Postives = 97/228 (42.54%), Query Frame = 2
Query:  134 CKKLRDIGLTGNPLNGILPSSIGNLSM----SLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLD-------------KLVLFGNKLSGSIPSCLSNLTSLR-SLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGP 763
            CKKL  + +  N  +  +PS+   L      SL+   IG C ++G IP  +                 G IP   G L  L  L L+ N L G  P EL  L  L              +L +F N  + +     + L+SL  ++Y+  N  T  IP     LK +   +   N   G +  ++ NL  L  ++LS NNLSG +P ++ GL  L   ++A N L GP
Sbjct:  441 CKKLSTLIMAKNFYDETVPSNKDFLRSDGFPSLQIFGIGACRLTGEIPAWLIKLQRVEVMDLSMNRFVGTIPGWLGTLPDLFYLDLSDNFLTGELPKELFQLRALMSQKAYDATERNYLELPVFVNPNNVTTNQQYNQLSSLPPTIYIKRNNLTGTIPVEVGQLKVLHILELLGNNFSGSIPDELSNLTNLERLDLSNNNLSGRIPWSLTGLHFLSYFNVANNTLSGP 668          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: Y1684_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g06840 OS=Arabidopsis thaliana GN=At1g06840 PE=1 SV=2)

HSP 1 Score: 85.5001 bits (210), Expect = 4.661e-16
Identity = 46/146 (31.51%), Postives = 80/146 (54.79%), Query Frame = 2
Query:  323 TGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            +G +    GRL +L  L   +NK+ GS P E+ ++  L+ L+L GN L+G++P  L  L +L  + +  NR +  +P +F +L     F  ++N + G +  ++G+L  ++ I L  NNLSG +P  +  +  L I+ L  N  +G
Sbjct:   96 SGNLSPELGRLSRLTILSFMWNKITGSIPKEIGNIKSLELLLLNGNLLNGNLPEELGFLPNLDRIQIDENRISGPLPKSFANLNKTKHFHMNNNSISGQIPPELGSLPSIVHILLDNNNLSGYLPPELSNMPRLLILQLDNNHFDG 241          

HSP 2 Score: 85.1149 bits (209), Expect = 6.088e-16
Identity = 53/192 (27.60%), Postives = 92/192 (47.92%), Query Frame = 2
Query:  191 SSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSG-DMPATIGGLKDLQIMDLAYNRLEGP 763
            S++ +  + +  L + + ++SGN+   +G               TG IP   G ++ L+ L L  N L G+ P+EL  L  LD++ +  N++SG +P   +NL   +  ++ +N  +  IP    SL  I+     +N L G L  ++ N+  LL + L  N+  G  +P + G +  L  M L    L+GP
Sbjct:   76 STLDDGYLHVSELQLFSMNLSGNLSPELGRLSRLTILSFMWNKITGSIPKEIGNIKSLELLLLNGNLLNGNLPEELGFLPNLDRIQIDENRISGPLPKSFANLNKTKHFHMNNNSISGQIPPELGSLPSIVHILLDNNNLSGYLPPELSNMPRLLILQLDNNHFDGTTIPQSYGNMSKLLKMSLRNCSLQGP 267          

HSP 3 Score: 82.8037 bits (203), Expect = 3.021e-15
Identity = 68/212 (32.08%), Postives = 97/212 (45.75%), Query Frame = 2
Query:  131 NCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSG-SIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLK-VLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            N K L  + L GN LNG LP  +G L  +L  + I    ISG +P+S                 +G IP   G L  +  + L  N L G  P EL ++ RL  L L  N   G +IP    N++ L  + L +      +P    S+ ++ + D S N L G + +  G L   +  I+LS N+L+G +P    GL  LQ + LA N L G
Sbjct:  129 NIKSLELLLLNGNLLNGNLPEELGFLP-NLDRIQIDENRISGPLPKSFANLNKTKHFHMNNNSISGQIPPELGSLPSIVHILLDNNNLSGYLPPELSNMPRLLILQLDNNHFDGTTIPQSYGNMSKLLKMSLRNCSLQGPVPD-LSSIPNLGYLDLSQNQLNGSIPA--GKLSDSITTIDLSNNSLTGTIPTNFSGLPRLQKLSLANNALSG 336          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: Y5344_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g53440 OS=Arabidopsis thaliana GN=At1g53440 PE=1 SV=2)

HSP 1 Score: 84.3445 bits (207), Expect = 1.038e-15
Identity = 54/173 (31.21%), Postives = 85/173 (49.13%), Query Frame = 2
Query:  245 SISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGP 763
            ++ G IP   G               +G IPTT  ++  L+ L +  N+L G FP +L  +  L  +++  N  +G +P  L NL SL+ L + SN  T  IP +  +LK++  F    N L G +   IGN   L+ ++L   ++ G +PA+I  LK+L   +L    L GP
Sbjct:   99 NLRGIIPPEFGNLTRLTEIDLVLNFLSGTIPTTLSQIP-LEILAVTGNRLSGPFPPQLGQITTLTDVIMESNLFTGQLPPNLGNLRSLKRLLISSNNITGRIPESLSNLKNLTNFRIDGNSLSGKIPDFIGNWTRLVRLDLQGTSMEGPIPASISNLKNL--TELRITDLRGP 268          

HSP 2 Score: 78.5666 bits (192), Expect = 5.698e-14
Identity = 64/236 (27.12%), Postives = 102/236 (43.22%), Query Frame = 2
Query:  131 NCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDIL-------------FFDFSS----------NFLV-GPLSSDIG-NLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGP 763
            N  +L +I L  N L+G +P+++  + + +  L +    +SG  P  +G               TG +P   G L+ L+ L ++ N + G  P+ L +L  L    + GN LSG IP  + N T L  L L        IP++  +LK++              F D  +          N L+  P+   IG ++ +L  ++LS N L+G +P T   L     M L  N L GP
Sbjct:  110 NLTRLTEIDLVLNFLSGTIPTTLSQIPLEI--LAVTGNRLSGPFPPQLGQITTLTDVIMESNLFTGQLPPNLGNLRSLKRLLISSNNITGRIPESLSNLKNLTNFRIDGNSLSGKIPDFIGNWTRLVRLDLQGTSMEGPIPASISNLKNLTELRITDLRGPTSPFPDLQNMTNMERLVLRNCLIREPIPEYIGTSMTMLKLLDLSSNMLNGTIPDTFRSLNAFNFMYLNNNSLTGP 343          

HSP 3 Score: 70.8626 bits (172), Expect = 1.188e-11
Identity = 57/187 (30.48%), Postives = 87/187 (46.52%), Query Frame = 2
Query:  131 NCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLA-FNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCL-SNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLS 685
            N + L+ + ++ N + G +P S+ NL  +L    I   S+SG IP  IG                GPIP +   L+ L  L +         FPD L ++  +++LVL    +   IP  + +++T L+ L L SN     IP TF SL    F   ++N L GP+   I + K    I+LS NN +
Sbjct:  181 NLRSLKRLLISSNNITGRIPESLSNLK-NLTNFRIDGNSLSGKIPDFIGNWTRLVRLDLQGTSMEGPIPASISNLKNLTELRITDLRGPTSPFPD-LQNMTNMERLVLRNCLIREPIPEYIGTSMTMLKLLDLSSNMLNGTIPDTFRSLNAFNFMYLNNNSLTGPVPQFILDSK--QNIDLSYNNFT 363          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: Y4372_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At4g37250 OS=Arabidopsis thaliana GN=At4g37250 PE=2 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 1.038e-15
Identity = 58/188 (30.85%), Postives = 92/188 (48.94%), Query Frame = 2
Query:  203 NLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIG-GLKDLQIMDLAYNRLEGP 763
            N    + TL + N  + G+IP  +G                GP+P +F   ++L+ L L+ N + G  P  +  L  L  L L  N L+G +P+ L++L +L  + L +N F+  IP  +   + + F D SSN + G L  D G    L  +N+S N +SG++P  IG        +DL++N L GP
Sbjct:   63 NNDSKVLTLSLPNSQLLGSIPSDLGSLLTLQSLDLSNNSFNGPLPVSFFNARELRFLDLSSNMISGEIPSAIGDLHNLLTLNLSDNALAGKLPTNLASLRNLTVVSLENNYFSGEIPGGW---RVVEFLDLSSNLINGSLPPDFGGYS-LQYLNVSFNQISGEIPPEIGVNFPRNVTVDLSFNNLTGP 246          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: Y2267_ARATH (Probable inactive receptor kinase At2g26730 OS=Arabidopsis thaliana GN=At2g26730 PE=1 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 1.771e-15
Identity = 53/134 (39.55%), Postives = 69/134 (51.49%), Query Frame = 2
Query:  362 LQGLYLAFNKLVGSFPD-ELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            +  L L    LVG  P   L  L  L  L L  N+LSG IPS  SNLT LRSLYL  N F+   P++F  L +++  D SSN   G +   + NL  L G+ L  N  SG++P+   GL D  + +   N L G
Sbjct:   68 IHSLRLPGTGLVGQIPSGSLGRLTELRVLSLRSNRLSGQIPSDFSNLTHLRSLYLQHNEFSGEFPTSFTQLNNLIRLDISSNNFTGSIPFSVNNLTHLTGLFLGNNGFSGNLPSISLGLVDFNVSN---NNLNG 198          

HSP 2 Score: 74.3294 bits (181), Expect = 1.075e-12
Identity = 47/141 (33.33%), Postives = 69/141 (48.94%), Query Frame = 2
Query:  215 SLKTLYIGNCSISGNIPQ-SIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDI 634
            S+ +L +    + G IP  S+G               +G IP+ F  L  L+ LYL  N+  G FP     L  L +L +  N  +GSIP  ++NLT L  L+LG+N F+  +PS    L D   F+ S+N L G + S +
Sbjct:   67 SIHSLRLPGTGLVGQIPSGSLGRLTELRVLSLRSNRLSGQIPSDFSNLTHLRSLYLQHNEFSGEFPTSFTQLNNLIRLDISSNNFTGSIPFSVNNLTHLTGLFLGNNGFSGNLPSISLGLVD---FNVSNNNLNGSIPSSL 204          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: Y1534_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g53420 OS=Arabidopsis thaliana GN=At1g53420 PE=2 SV=2)

HSP 1 Score: 83.5741 bits (205), Expect = 1.771e-15
Identity = 59/208 (28.37%), Postives = 98/208 (47.12%), Query Frame = 2
Query:  143 LRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLS--SDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            L++I L+ N LNG +P   G L + +    +GN  ++G IP+  G               +G +P   G L  +Q + L+ N   G  P     L  L    +  N+LSG+IP  +   T L  L++ ++     IP    SL ++   D   + L GP S    + N+K +  + L   NL+GD+P  +G +   + +DL++N+L G
Sbjct:   89 LQEIDLSRNYLNGSIPPEWGVLPL-VNIWLLGN-RLTGPIPKEFGNITTLTSLVLEANQLSGELPLELGNLPNIQQMILSSNNFNGEIPSTFAKLTTLRDFRVSDNQLSGTIPDFIQKWTKLERLFIQASGLVGPIPIAIASLVELK--DLRISDLNGPESPFPQLRNIKKMETLILRNCNLTGDLPDYLGKITSFKFLDLSFNKLSG 292          

HSP 2 Score: 77.0258 bits (188), Expect = 1.658e-13
Identity = 54/173 (31.21%), Postives = 81/173 (46.82%), Query Frame = 2
Query:  245 SISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGP 763
            ++ G++P+ +                 G IP  +G L  L  ++L  N+L G  P E  ++  L  LVL  N+LSG +P  L NL +++ + L SN F   IPSTF  L  +  F  S N L G +   I     L  + +  + L G +P  I  L +L+  DL  + L GP
Sbjct:   74 NLQGSLPKELVGLPLLQEIDLSRNYLNGSIPPEWGVLP-LVNIWLLGNRLTGPIPKEFGNITTLTSLVLEANQLSGELPLELGNLPNIQQMILSSNNFNGEIPSTFAKLTTLRDFRVSDNQLSGTIPDFIQKWTKLERLFIQASGLVGPIPIAIASLVELK--DLRISDLNGP 243          

HSP 3 Score: 76.2554 bits (186), Expect = 2.828e-13
Identity = 65/248 (26.21%), Postives = 107/248 (43.15%), Query Frame = 2
Query:   20 GFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGS-NRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            G +P  +  L  L+ + L  NY               N      I L GN L G +P   GN++ +L +L +    +SG +P  +G                G IP+TF +L  L+   ++ N+L G+ PD +    +L++L +  + L G IP  +++L  L+ L +   N   S  P    ++K +      +  L G L   +G +     ++LS N LSG +P T   L+D   +    N L G
Sbjct:   77 GSLPKELVGLPLLQEIDLSRNYLNGSIPPEWGVLPLVN------IWLLGNRLTGPIPKEFGNIT-TLTSLVLEANQLSGELPLELGNLPNIQQMILSSNNFNGEIPSTFAKLTTLRDFRVSDNQLSGTIPDFIQKWTKLERLFIQASGLVGPIPIAIASLVELKDLRISDLNGPESPFPQ-LRNIKKMETLILRNCNLTGDLPDYLGKITSFKFLDLSFNKLSGAIPNTYINLRDGGYIYFTGNMLNG 316          

HSP 4 Score: 73.9442 bits (180), Expect = 1.403e-12
Identity = 62/226 (27.43%), Postives = 102/226 (45.13%), Query Frame = 2
Query:   17 SGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLA-FNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGD 691
            +G IP   GN+  L  L L  N                N   ++ + L+ N  NG +PS+   L+ +L+   + +  +SG IP  I                 GPIP     L +L+ L ++  N     FP +L ++ +++ L+L    L+G +P  L  +TS + L L  N+ +  IP+T+ +L+D  +  F+ N L G +   + N      I+LS NN S D
Sbjct:  123 TGPIPKEFGNITTLTSLVLEANQLSGELPLEL-----GNLPNIQQMILSSNNFNGEIPSTFAKLT-TLRDFRVSDNQLSGTIPDFIQKWTKLERLFIQASGLVGPIPIAIASLVELKDLRISDLNGPESPFP-QLRNIKKMETLILRNCNLTGDLPDYLGKITSFKFLDLSFNKLSGAIPNTYINLRDGGYIYFTGNMLNGSVPDWMVNKG--YKIDLSYNNFSVD 339          

HSP 5 Score: 68.1662 bits (165), Expect = 7.701e-11
Identity = 51/155 (32.90%), Postives = 75/155 (48.39%), Query Frame = 2
Query:  326 GPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGPXLXXIVTLI 790
            G +P     L  LQ + L+ N L GS P E   L  L  + L GN+L+G IP    N+T+L SL L +N+ +  +P    +L +I     SSN   G + S    L  L    +S+N LSG +P  I     L+ + +  + L GP    I +L+
Sbjct:   77 GSLPKELVGLPLLQEIDLSRNYLNGSIPPEWGVLP-LVNIWLLGNRLTGPIPKEFGNITTLTSLVLEANQLSGELPLELGNLPNIQQMILSSNNFNGEIPSTFAKLTTLRDFRVSDNQLSGTIPDFIQKWTKLERLFIQASGLVGPIPIAIASLV 230          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: PGIP1_ARATH (Polygalacturonase inhibitor 1 OS=Arabidopsis thaliana GN=PGIP1 PE=2 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 2.313e-15
Identity = 63/187 (33.69%), Postives = 87/187 (46.52%), Query Frame = 2
Query:  203 NLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXX-TGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLK-DILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLE 757
            N  ++  T++ G   ISG IP  +G                TG I  T  +L+ L+ L L++  L G  PD +  L  L+ L L  N LSGSIPS LS L  + +L L  N+ T  IP +F S    +     S N L GP+   +GN+     I+LS N L GD     G  K    +DL+ N  +
Sbjct:   69 NHRVTALTIFSGQ--ISGQIPAEVGDLPYLETLVFRKLSNLTGTIQPTIAKLKNLRMLRLSWTNLTGPIPDFISQLKNLEFLELSFNDLSGSIPSSLSTLPKILALELSRNKLTGSIPESFGSFPGTVPDLRLSHNQLSGPIPKSLGNID-FNRIDLSRNKLQGDASMLFGSNKTTWSIDLSRNMFQ 252          

HSP 2 Score: 78.1814 bits (191), Expect = 7.442e-14
Identity = 63/198 (31.82%), Postives = 96/198 (48.48%), Query Frame = 2
Query:  173 LNGILPSSIGNLSMSLKTLYIGNCS-ISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLT-SLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            ++G +P+ +G+L   L+TL     S ++G I  +I                TGPIP    +L+ L+ L L+FN L GS P  L  L ++  L L  NKL+GSIP    +   ++  L L  N+ +  IP +  ++ D    D S N L G  S   G+ K    I+LS N    D+ + +   K L I+DL +N + G
Sbjct:   82 ISGQIPAEVGDLPY-LETLVFRKLSNLTGTIQPTIAKLKNLRMLRLSWTNLTGPIPDFISQLKNLEFLELSFNDLSGSIPSSLSTLPKILALELSRNKLTGSIPESFGSFPGTVPDLRLSHNQLSGPIPKSLGNI-DFNRIDLSRNKLQGDASMLFGSNKTTWSIDLSRNMFQFDI-SKVDIPKTLGILDLNHNGITG 276          
The following BLAST results are available for this feature:
BLAST of EY659338 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 91
Match NameE-valueIdentityDescription
Y2165_ARATH2.920e-1830.00Probable LRR receptor-like serine/threonine-protei... [more]
Y5374_ARATH1.892e-1728.83Probable LRR receptor-like serine/threonine-protei... [more]
RPK2_ARATH2.733e-1633.87LRR receptor-like serine/threonine-protein kinase ... [more]
PSYR1_ARATH3.569e-1632.23Tyrosine-sulfated glycopeptide receptor 1 OS=Arabi... [more]
Y1684_ARATH4.661e-1631.51Probable LRR receptor-like serine/threonine-protei... [more]
Y5344_ARATH1.038e-1531.21Probable LRR receptor-like serine/threonine-protei... [more]
Y4372_ARATH1.038e-1530.85Probable LRR receptor-like serine/threonine-protei... [more]
Y2267_ARATH1.771e-1539.55Probable inactive receptor kinase At2g26730 OS=Ara... [more]
Y1534_ARATH1.771e-1528.37Probable LRR receptor-like serine/threonine-protei... [more]
PGIP1_ARATH2.313e-1533.69Polygalacturonase inhibitor 1 OS=Arabidopsis thali... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-002-A11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659338 ID=EY659338|Name=EY659338|organism=Citrus sinensis|type=EST|length=918bp
CCACGCGTCCGCATTTTCGGGATTTATTCCAAACACAATTGGTAATTTAA
GAAACCTTGAGTGGCTCGGCTTGGGTAATAACTACTTGACATCTTCAACC
TCAAAATTGAGCTTTCTTTCCTCTTTGGCAAATTGCAAGAAATTAAGAGA
CATAGGCTTAACAGGCAATCCACTCAACGGTATCCTTCCAAGTTCAATAG
GTAATCTTTCCATGTCTTTGAAAACACTTTACATCGGCAATTGCAGTATT
AGTGGCAACATTCCTCAATCAATTGGCAATTTAAGCAACTTATTGGCCTT
AGTATTAGAACTCAATAAATTGACTGGACCTATCCCAACTACATTCGGCC
GACTGCAGAAACTCCAAGGCTTATATCTTGCATTCAATAAGTTGGTAGGT
TCATTCCCAGATGAGCTTTGCCATCTAGGAAGGCTGGATAAATTGGTCTT
ATTTGGCAATAAGCTTTCAGGATCTATACCTTCATGCTTAAGTAATCTCA
CTTCTCTGAGATCTCTCTACTTAGGGTCCAATAGGTTTACTTCTGTCATT
CCCTCAACTTTCTGGAGCCTAAAAGACATCTTGTTCTTTGACTTTTCATC
AAATTTCTTGGTGGGTCCTCTTTCTTCAGACATAGGTAATTTGAAGGTGC
TTCTAGGAATAAATTTATCAGAAAATAACTTATCGGGTGATATGCCAGCC
ACAATTGGAGGACTGAAAGATCTTCAAATTATGGACCTAGCATATAATAG
ATTGGAAGGCCCANTNCTGNANNTCATTGTGACTTTGATAGTTTAGAAAG
TTTGAATTTGTCAAATATAAAATCTCCGGGTCTATTCCAAAATCCNTGGG
GAACTCTTTTACCTCGAGAAGTAATCTCTCTTTCATGAACTAGAAGTGAG
ATTCTAGTGGAGAATTTT
back to top