EY659338

Overview
NameEY659338
Unique NameEY659338
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length918
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: FEI2_ARATH (LRR receptor-like serine/threonine-protein kinase FEI 2 OS=Arabidopsis thaliana GN=FEI2 PE=1 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 2.165e-13
Identity = 45/121 (37.19%), Postives = 66/121 (54.55%), Query Frame = 2
Query:  338 TTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPA 700
            T   + +++  L L ++KL G  P EL  L +L  L+L  N L  SIP+ L N T+L  +YL +N  T  IPS   +L  +   D S+N L G + + +G LK L   N+S N L G +P+
Sbjct:   67 TCDAKTKRVIALSLTYHKLRGPLPPELGKLDQLRLLMLHNNALYQSIPASLGNCTALEGIYLQNNYITGTIPSEIGNLSGLKNLDLSNNNLNGAIPASLGQLKRLTKFNVSNNFLVGKIPS 187          

HSP 2 Score: 72.0182 bits (175), Expect = 5.333e-12
Identity = 39/102 (38.24%), Postives = 60/102 (58.82%), Query Frame = 2
Query:  326 GPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSD 631
            GP+P   G+L +L+ L L  N L  S P  L +   L+ + L  N ++G+IPS + NL+ L++L L +N     IP++   LK +  F+ S+NFLVG + SD
Sbjct:   87 GPLPPELGKLDQLRLLMLHNNALYQSIPASLGNCTALEGIYLQNNYITGTIPSEIGNLSGLKNLDLSNNNLNGAIPASLGQLKRLTKFNVSNNFLVGKIPSD 188          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: Y2242_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At2g24230 OS=Arabidopsis thaliana GN=At2g24230 PE=2 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 2.828e-13
Identity = 73/250 (29.20%), Postives = 116/250 (46.40%), Query Frame = 2
Query:   11 AFSGFIP-NTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDEL-CHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDI-GNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNR 751
            + SG IP NTIG L  L+ L L NN                +   L+++ L+ N ++G   S++GN    L+ L I   + SG IP+++                   IP      Q L  + L+ N+L GS PD       +L+ L L GNK+ G   +  +++ S+  L +  N+F   +   F    ++   D S N   G +SS +  N   L+ ++LSEN LSG +   +  LK L+ ++LA+NR
Sbjct:   78 SLSGQIPDNTIGKLSKLQSLDLSNNKISALPSDFW------SLNTLKNLNLSFNKISGSFSSNVGNFG-QLELLDISYNNFSGAIPEAVDSLVSLRVLKLDHNGFQMSIPRGLLGCQSLVSIDLSSNQLEGSLPDGFGSAFPKLETLSLAGNKIHGR-DTDFADMKSISFLNISGNQFDGSVTGVFKETLEVA--DLSKNRFQGHISSQVDSNWFSLVYLDLSENELSG-VIKNLTLLKKLKHLNLAWNR 316          

HSP 2 Score: 75.485 bits (184), Expect = 4.824e-13
Identity = 55/202 (27.23%), Postives = 85/202 (42.08%), Query Frame = 2
Query:  227 LYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPL------------------------SSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            L     S+SG IP +                    +P+ F  L  L+ L L+FNK+ GSF   + + G+L+ L +  N  SG+IP  + +L SLR L L  N F   IP      + ++  D SSN L G L                         +D  ++K +  +N+S N   G +       + L++ DL+ NR +G
Sbjct:   72 LIASGMSLSGQIPDNTIGKLSKLQSLDLSNNKISALPSDFWSLNTLKNLNLSFNKISGSFSSNVGNFGQLELLDISYNNFSGAIPEAVDSLVSLRVLKLDHNGFQMSIPRGLLGCQSLVSIDLSSNQLEGSLPDGFGSAFPKLETLSLAGNKIHGRDTDFADMKSISFLNISGNQFDGSVTGVF--KETLEVADLSKNRFQG 271          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: TMKL1_ARATH (Putative kinase-like protein TMKL1 OS=Arabidopsis thaliana GN=TMKL1 PE=1 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 4.824e-13
Identity = 57/175 (32.57%), Postives = 84/175 (48.00%), Query Frame = 2
Query:  191 SSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLF---GNKLSGSIPS-CLSNLT--SLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMP 697
            S   + S+ L +L + + +++G++P+ IG               +G IP   G    L  + L+ N L G  P  + +L   DKLV F   GN LSG +P   L N T  +L+ L LG N+F+   P      K +   D SSN   G +   +G L+ L  +NLS NN SG +P
Sbjct:   92 SLFNDSSLHLLSLQLPSANLTGSLPREIGEFSMLQSVFLNINSLSGSIPLELGYTSSLSDVDLSGNALAGVLPPSIWNL--CDKLVSFKIHGNNLSGVLPEPALPNSTCGNLQVLDLGGNKFSGEFPEFITRFKGVKSLDLSSNVFEGLVPEGLGVLE-LESLNLSHNNFSGMLP 263          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: Y1634_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g63430 OS=Arabidopsis thaliana GN=At1g63430 PE=1 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.833e-12
Identity = 47/146 (32.19%), Postives = 72/146 (49.32%), Query Frame = 2
Query:  377 LAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDM-----------------PATIGGL-KDLQIMDLAYNRLEG 760
            ++ + + G    EL  +  L +L+L GN L G+IP  + NL +L+ L LG+N     IP+   SL  I+  +  SN L G L +++GNLK L  +++  N L G +                  A I GL K L++ D +YN   G
Sbjct:   76 ISASSIKGFLAPELGQITYLQELILHGNILIGTIPKEIGNLKNLKILDLGNNHLMGPIPAEIGSLSGIMIINLQSNGLTGKLPAELGNLKYLRELHIDRNRLQGSLLVAGASGYQSKVYSSNSSANIAGLCKSLKVADFSYNFFVG 221          

HSP 2 Score: 72.0182 bits (175), Expect = 5.333e-12
Identity = 37/110 (33.64%), Postives = 62/110 (56.36%), Query Frame = 2
Query:  440 KLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGPXL 769
            K+ +  + + G +   L  +T L+ L L  N     IP    +LK++   D  +N L+GP+ ++IG+L  ++ INL  N L+G +PA +G LK L+ + +  NRL+G  L
Sbjct:   73 KINISASSIKGFLAPELGQITYLQELILHGNILIGTIPKEIGNLKNLKILDLGNNHLMGPIPAEIGSLSGIMIINLQSNGLTGKLPAELGNLKYLRELHIDRNRLQGSLL 182          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: PGIP3_PHAVU (Polygalacturonase inhibitor 3 OS=Phaseolus vulgaris GN=PGIP3 PE=1 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.833e-12
Identity = 60/209 (28.71%), Postives = 91/209 (43.54%), Query Frame = 2
Query:  140 KLRDIGLTGN--PLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDIL-FFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLE 757
            ++ ++ L+G+  P    +PSS+ NL   L  LYIG  +                          GPIP    +L +L  LY+    + G+ PD L  +  L  L    N LSG++P  +S+L +L  +    NR +  IP ++ S   +      S N L G +     NL  L  ++LS N L GD     G  K+ Q + LA N L+
Sbjct:   80 RVNNLDLSGHNLPKPYPIPSSLANLPY-LNFLYIGGIN-----------------------NLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLN-LAFVDLSRNMLQGDASVLFGSDKNTQKIHLAKNSLD 263          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: Y2278_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At2g02780 OS=Arabidopsis thaliana GN=At2g02780 PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 2.394e-12
Identity = 62/207 (29.95%), Postives = 95/207 (45.89%), Query Frame = 2
Query:  143 LRDIGLTGNPLNGIL-PSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            L+ + LT   ++G L P  I  LS SL++L + +  ISG IP+ I                          L+ L+ L L  N   G   D+L  L  L +L L GNKL   +PS  S LT++    L +N F S IP     L ++   D SSN   G +   + ++  L  ++L +N LSG +P +      +  +D+++N L G
Sbjct:  107 LKTLSLTSLGISGSLSPKIITKLSPSLESLNLSSNFISGKIPEEIVS------------------------LKNLKSLVLRDNMFWGFVSDDLRGLSNLQELDLGGNKLGPEVPSLPSKLTTVS---LKNNSFRSKIPEQIKKLNNLQSLDLSSNEFTGSIPEFLFSIPSLQILSLDQNLLSGSLPNSSCTSSKIITLDVSHNLLTG 286          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: RPKL_ARATH (Receptor protein kinase-like protein At4g34220 OS=Arabidopsis thaliana GN=At4g34220 PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 2.394e-12
Identity = 45/134 (33.58%), Postives = 73/134 (54.48%), Query Frame = 2
Query:  359 KLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            ++  L L    L+GS   +L  +  L  L L  N  +GS+P  + N T L+S+ LGSN  +  +P +  S+ ++   + S+N   G +  +I  LK L  ++LS+N  SGD+P+   G +  QI+DL+ N L G
Sbjct:   80 RVTSLVLPNKHLLGSITPDLFSIPYLRILDLSSNFFNGSLPDSVFNATELQSISLGSNNLSGDLPKSVNSVTNLQLLNLSANAFTGEIPLNISLLKNLTVVSLSKNTFSGDIPS---GFEAAQILDLSSNLLNG 210          

HSP 2 Score: 70.8626 bits (172), Expect = 1.188e-11
Identity = 46/145 (31.72%), Postives = 75/145 (51.72%), Query Frame = 2
Query:  326 GPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            G I      +  L+ L L+ N   GS PD + +   L  + L  N LSG +P  ++++T+L+ L L +N FT  IP     LK++     S N   G + S     ++L   +LS N L+G +P  +GG K L  ++L++N++ G
Sbjct:   93 GSITPDLFSIPYLRILDLSSNFFNGSLPDSVFNATELQSISLGSNNLSGDLPKSVNSVTNLQLLNLSANAFTGEIPLNISLLKNLTVVSLSKNTFSGDIPSGFEAAQIL---DLSSNLLNGSLPKDLGG-KSLHYLNLSHNKVLG 233          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: LAP1_CAEEL (Protein lap1 OS=Caenorhabditis elegans GN=let-413 PE=1 SV=3)

HSP 1 Score: 72.7886 bits (177), Expect = 3.127e-12
Identity = 69/243 (28.40%), Postives = 112/243 (46.09%), Query Frame = 2
Query:   26 IPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRL 754
            +P+ IG+L NL  L   +N                  +KL ++ L  N L   LP+ IG L+ SL+  Y+   S++ ++P SI                   +P   GR+  L  L ++ N+++   P     L RL  L    N L  ++ S +    SL  LYLG N F + +P T   L+ +   +   N L   +   IGN K L  ++L +N L+ ++P TIG  ++L ++D+A N+L
Sbjct:  143 LPSNIGSLTNLRVLEARDNLLRTIPLSI------VELRKLEELDLGQNELEA-LPAEIGKLT-SLREFYVDINSLT-SLPDSISGCRMLDQLDVSENQIIR-LPENLGRMPNLTDLNISINEII-ELPSSFGELKRLQMLKADRNSLH-NLTSEIGKCQSLTELYLGQN-FLTDLPDTIGDLRQLTTLNVDCNNL-SDIPDTIGNCKSLTVLSLRQNILT-ELPMTIGKCENLTVLDVASNKL 370          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: PGIP2_PHAVU (Polygalacturonase inhibitor 2 OS=Phaseolus vulgaris GN=PGIP2 PE=1 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 4.083e-12
Identity = 57/191 (29.84%), Postives = 81/191 (42.41%), Query Frame = 2
Query:  185 LPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDIL-FFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRL 754
            +PSS+ NL   L  LYIG  +                          GPIP    +L +L  LY+    + G+ PD L  +  L  L    N LSG++P  +S+L +L  +    NR +  IP ++ S   +      S N L G +     NL  L  ++LS N L GD     G  K+ Q + LA N L
Sbjct:   97 IPSSLANLPY-LNFLYIGGIN-----------------------NLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLN-LAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSL 262          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: PGIP1_PHAVU (Polygalacturonase inhibitor 1 OS=Phaseolus vulgaris GN=PGIP1 PE=1 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 6.965e-12
Identity = 59/208 (28.37%), Postives = 90/208 (43.27%), Query Frame = 2
Query:  140 KLRDIGLTGN--PLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDIL-FFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRL 754
            ++ ++ L+G+  P    +PSS+ NL   L  LYIG  +                          GPIP    +L +L  LY+    + G+ PD L  +  L  L    N LSG++P  +S+L +L  +    NR +  IP ++ S   +      S N L G +     NL  L  ++LS N L GD     G  K+ + + LA N L
Sbjct:   80 RVNNLDLSGHNLPKPYPIPSSLANLPY-LNFLYIGGIN-----------------------NLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLGGITFDGNRISGAIPDSYGSFSKLFTAMTISRNRLTGKIPPTFANLN-LAFVDLSRNMLEGDASVLFGSDKNTKKIHLAKNSL 262          
The following BLAST results are available for this feature:
BLAST of EY659338 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 91
Match NameE-valueIdentityDescription
FEI2_ARATH2.165e-1337.19LRR receptor-like serine/threonine-protein kinase ... [more]
Y2242_ARATH2.828e-1329.20Probable LRR receptor-like serine/threonine-protei... [more]
TMKL1_ARATH4.824e-1332.57Putative kinase-like protein TMKL1 OS=Arabidopsis ... [more]
Y1634_ARATH1.833e-1232.19Probable LRR receptor-like serine/threonine-protei... [more]
PGIP3_PHAVU1.833e-1228.71Polygalacturonase inhibitor 3 OS=Phaseolus vulgari... [more]
Y2278_ARATH2.394e-1229.95Probable LRR receptor-like serine/threonine-protei... [more]
RPKL_ARATH2.394e-1233.58Receptor protein kinase-like protein At4g34220 OS=... [more]
LAP1_CAEEL3.127e-1228.40Protein lap1 OS=Caenorhabditis elegans GN=let-413 ... [more]
PGIP2_PHAVU4.083e-1229.84Polygalacturonase inhibitor 2 OS=Phaseolus vulgari... [more]
PGIP1_PHAVU6.965e-1228.37Polygalacturonase inhibitor 1 OS=Phaseolus vulgari... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-002-A11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659338 ID=EY659338|Name=EY659338|organism=Citrus sinensis|type=EST|length=918bp
CCACGCGTCCGCATTTTCGGGATTTATTCCAAACACAATTGGTAATTTAA
GAAACCTTGAGTGGCTCGGCTTGGGTAATAACTACTTGACATCTTCAACC
TCAAAATTGAGCTTTCTTTCCTCTTTGGCAAATTGCAAGAAATTAAGAGA
CATAGGCTTAACAGGCAATCCACTCAACGGTATCCTTCCAAGTTCAATAG
GTAATCTTTCCATGTCTTTGAAAACACTTTACATCGGCAATTGCAGTATT
AGTGGCAACATTCCTCAATCAATTGGCAATTTAAGCAACTTATTGGCCTT
AGTATTAGAACTCAATAAATTGACTGGACCTATCCCAACTACATTCGGCC
GACTGCAGAAACTCCAAGGCTTATATCTTGCATTCAATAAGTTGGTAGGT
TCATTCCCAGATGAGCTTTGCCATCTAGGAAGGCTGGATAAATTGGTCTT
ATTTGGCAATAAGCTTTCAGGATCTATACCTTCATGCTTAAGTAATCTCA
CTTCTCTGAGATCTCTCTACTTAGGGTCCAATAGGTTTACTTCTGTCATT
CCCTCAACTTTCTGGAGCCTAAAAGACATCTTGTTCTTTGACTTTTCATC
AAATTTCTTGGTGGGTCCTCTTTCTTCAGACATAGGTAATTTGAAGGTGC
TTCTAGGAATAAATTTATCAGAAAATAACTTATCGGGTGATATGCCAGCC
ACAATTGGAGGACTGAAAGATCTTCAAATTATGGACCTAGCATATAATAG
ATTGGAAGGCCCANTNCTGNANNTCATTGTGACTTTGATAGTTTAGAAAG
TTTGAATTTGTCAAATATAAAATCTCCGGGTCTATTCCAAAATCCNTGGG
GAACTCTTTTACCTCGAGAAGTAATCTCTCTTTCATGAACTAGAAGTGAG
ATTCTAGTGGAGAATTTT
back to top