EY659338

Overview
NameEY659338
Unique NameEY659338
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length918
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: Y5659_ARATH (Probable inactive receptor kinase At5g16590 OS=Arabidopsis thaliana GN=At5g16590 PE=1 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.552e-11
Identity = 46/132 (34.85%), Postives = 62/132 (46.97%), Query Frame = 2
Query:  323 TGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKV-LLGINLSENNLSGDMPATIGGL 715
            +GP+P   G L KL+ L   FN L G  P +  +L  L  L L GN  SG IPS L  L ++  + L  N F   IP    S   +       N L GP    I  +K+ L   N+S N L+G +P  + G+
Sbjct:   76 SGPLPIAIGNLTKLETLSFRFNALNGPLPPDFANLTLLRYLYLQGNAFSGEIPSFLFTLPNIIRINLAQNNFLGRIPDNVNSATRLATLYLQDNQLTGP----IPEIKIKLQQFNVSSNQLNGSIPDPLSGM 203          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: SERK1_ARATH (Somatic embryogenesis receptor kinase 1 OS=Arabidopsis thaliana GN=SERK1 PE=1 SV=2)

HSP 1 Score: 70.4774 bits (171), Expect = 1.552e-11
Identity = 45/133 (33.83%), Postives = 65/133 (48.87%), Query Frame = 2
Query:  233 IGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNF-LVGPLSS 628
            +GN  +SG++   +G               TGPIP+  G L  L  L L  N   G  P+ L  L +L  L L  N L+GSIP  L+N+T+L+ L L +NR +  +P    S        F++N  L GP++S
Sbjct:   76 LGNAELSGHLVPELGVLKNLQYLELYSNNITGPIPSNLGNLTNLVSLDLYLNSFSGPIPESLGKLSKLRFLRLNNNSLTGSIPMSLTNITTLQVLDLSNNRLSGSVPDN-GSFSLFTPISFANNLDLCGPVTS 207          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: Y4374_ARATH (Probable inactive receptor kinase At4g23740 OS=Arabidopsis thaliana GN=At4g23740 PE=1 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 2.027e-11
Identity = 43/111 (38.74%), Postives = 61/111 (54.95%), Query Frame = 2
Query:  431 RLDKLVLFGNKLSGSIP-SCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            R+  + L G  L+G IP + +S L++LR L L SN  +   P  F  LKD+ F     N L GPL  D    K L  +NLS N  +G +P+++  LK +Q ++LA N L G
Sbjct:   69 RIIAVRLPGVGLNGQIPPNTISRLSALRVLSLRSNLISGEFPKDFVELKDLAFLYLQDNNLSGPLPLDFSVWKNLTSVNLSNNGFNGTIPSSLSRLKRIQSLNLANNTLSG 179          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: TMK1_ARATH (Probable receptor protein kinase TMK1 OS=Arabidopsis thaliana GN=TMK1 PE=1 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 2.647e-11
Identity = 57/188 (30.32%), Postives = 92/188 (48.94%), Query Frame = 2
Query:  143 LRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSI-SGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFG--RLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMP 697
            L+ + L+ N  + I PS +     SL+++ I N    S  IP+S+                +G +P   G      L  L+LAFN L G  P  L    ++  L L G KL+G I + L N+T L+ ++L SN+F+  +P  F  LK++       N   GP+ + + +L+ L  +NL+ N+L G +P
Sbjct:  113 LQVLMLSNNNFDSI-PSDVFQGLTSLQSVEIDNNPFKSWEIPESLRNASALQNFSANSANVSGSLPGFLGPDEFPGLSILHLAFNNLEGELPMSLAG-SQVQSLWLNGQKLTGDI-TVLQNMTGLKEVWLHSNKFSGPLPD-FSGLKELESLSLRDNSFTGPVPASLLSLESLKVVNLTNNHLQGPVP 296          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: Y5815_ARATH (Probably inactive leucine-rich repeat receptor-like protein kinase At5g58150 OS=Arabidopsis thaliana GN=At5g58150 PE=1 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 3.457e-11
Identity = 76/278 (27.34%), Postives = 110/278 (39.57%), Query Frame = 2
Query:   17 SGFIP-NTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDEL-CHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTS----VIPSTFWSLKDILFFDFSSNFLVGPLSS------------------------DIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            SG IP NTIG +  L+ L L  N                +   L  + L+ N ++  LPS+IGN  MSL TL +   SISG IP +I                   +P      + L  + L+ N+L  S P         L  L L  N   GS+   L    ++ ++ L  NRF      +IP    +   ++  D S N  VG + +                        +IG L  L  +NLS  NL+  +P  I  L  L+++DL+ N L G
Sbjct:   78 SGSIPDNTIGKMSKLQTLDLSGNKITSLPSDLW------SLSLLESLNLSSNRISEPLPSNIGNF-MSLHTLDLSFNSISGKIPAAISNLVNLTTLKLHNNDFQFGVPPELVHCRSLLSIDLSSNRLNESLPVGFGSAFPLLKSLNLSRNLFQGSLIGVLHE--NVETVDLSENRFDGHILQLIPGHKHNWSSLIHLDLSDNSFVGHIFNGLSSAHKLGHLNLACNRFRAQEFPEIGKLSALHYLNLSRTNLTNIIPREISRLSHLKVLDLSSNNLTG 346          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: Y5457_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At5g45780 OS=Arabidopsis thaliana GN=At5g45780 PE=2 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 3.457e-11
Identity = 39/112 (34.82%), Postives = 58/112 (51.79%), Query Frame = 2
Query:  428 GRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGP 763
            G +  L +    LSG + + +  LT L +L L +N+ T  IPS    L ++   D S N   G + + +G L  L  + LS N LSG +P  + GL  L  +DL++N L GP
Sbjct:   79 GFVVSLEMASKGLSGILSTSIGELTHLHTLLLQNNQLTGPIPSELGQLSELETLDLSGNRFSGEIPASLGFLTHLNYLRLSRNLLSGQVPHLVAGLSGLSFLDLSFNNLSGP 190          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: SRF1_ARATH (Protein STRUBBELIG-RECEPTOR FAMILY 1 OS=Arabidopsis thaliana GN=SRF1 PE=2 SV=2)

HSP 1 Score: 69.3218 bits (168), Expect = 3.457e-11
Identity = 50/148 (33.78%), Postives = 70/148 (47.30%), Query Frame = 2
Query:  326 GPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDL--AYNRLEGP 763
            G +         L+ +  + N + GS P  L     L  L L GN  +G+IP  LS+L SL  + L +N  +  IP  F  L  ++  D SSN L GPL   + NL  L  + L  N+LSG++      L+DL + DL    N   GP
Sbjct:   90 GELGVGLNMFTSLKAMDFSNNHIGGSIPSTLPV--SLQNLFLSGNNFTGTIPESLSSLKSLSVMSLNNNLLSGKIPDVFQDLGLMINIDLSSNNLSGPLPPSMQNLSTLTSLLLQNNHLSGELDV----LQDLPLKDLNVENNLFNGP 231          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: Y2239_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At2g23950 OS=Arabidopsis thaliana GN=At2g23950 PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 4.515e-11
Identity = 35/100 (35.00%), Postives = 54/100 (54.00%), Query Frame = 2
Query:  464 LSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGP 763
            LSG++   + NLT+LR + L +N  +  IP    SL  +   D S+N   G +   +  L  L  + L+ N+LSG  PA++  +  L  +DL+YN L GP
Sbjct:   86 LSGTLSGSIGNLTNLRQVSLQNNNISGKIPPEICSLPKLQTLDLSNNRFSGEIPGSVNQLSNLQYLRLNNNSLSGPFPASLSQIPHLSFLDLSYNNLRGP 185          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: SERK2_ARATH (Somatic embryogenesis receptor kinase 2 OS=Arabidopsis thaliana GN=SERK2 PE=1 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 4.515e-11
Identity = 39/102 (38.24%), Postives = 55/102 (53.92%), Query Frame = 2
Query:  392 LVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMP 697
            L G    +L  L  L  L L+ N ++G +PS L NLT+L SL L  N FT  IP +   L  + F   ++N L GP+   + N+  L  ++LS N LSG +P
Sbjct:   84 LSGQLVPQLGQLKNLQYLELYSNNITGPVPSDLGNLTNLVSLDLYLNSFTGPIPDSLGKLFKLRFLRLNNNSLTGPIPMSLTNIMTLQVLDLSNNRLSGSVP 185          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: Y5332_ARATH (Probable inactive receptor kinase At5g53320 OS=Arabidopsis thaliana GN=At5g53320 PE=1 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 7.701e-11
Identity = 47/135 (34.81%), Postives = 70/135 (51.85%), Query Frame = 2
Query:  362 LQGLYLAFNKLVGSFP-DELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMP-ATIGGLKDLQIMDLAYNRLEG 760
            +  L+LA   L G      +  L  L  L+L  N +SG+ P+ L  L +L  L L  N F+  +PS   S + +   D S+N   G + S IG L +L  +NL+ N  SG++P   I GLK   +++LA+N L G
Sbjct:   67 VDALHLAATGLRGDIELSIIARLSNLRFLILSSNNISGTFPTTLQALKNLTELKLDFNEFSGPLPSDLSSWERLQVLDLSNNRFNGSIPSSIGKLTLLHSLNLAYNKFSGEIPDLHIPGLK---LLNLAHNNLTG 198          
The following BLAST results are available for this feature:
BLAST of EY659338 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 91
Match NameE-valueIdentityDescription
Y5659_ARATH1.552e-1134.85Probable inactive receptor kinase At5g16590 OS=Ara... [more]
SERK1_ARATH1.552e-1133.83Somatic embryogenesis receptor kinase 1 OS=Arabido... [more]
Y4374_ARATH2.027e-1138.74Probable inactive receptor kinase At4g23740 OS=Ara... [more]
TMK1_ARATH2.647e-1130.32Probable receptor protein kinase TMK1 OS=Arabidops... [more]
Y5815_ARATH3.457e-1127.34Probably inactive leucine-rich repeat receptor-lik... [more]
Y5457_ARATH3.457e-1134.82Probable LRR receptor-like serine/threonine-protei... [more]
SRF1_ARATH3.457e-1133.78Protein STRUBBELIG-RECEPTOR FAMILY 1 OS=Arabidopsi... [more]
Y2239_ARATH4.515e-1135.00Probable LRR receptor-like serine/threonine-protei... [more]
SERK2_ARATH4.515e-1138.24Somatic embryogenesis receptor kinase 2 OS=Arabido... [more]
Y5332_ARATH7.701e-1134.81Probable inactive receptor kinase At5g53320 OS=Ara... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-002-A11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659338 ID=EY659338|Name=EY659338|organism=Citrus sinensis|type=EST|length=918bp
CCACGCGTCCGCATTTTCGGGATTTATTCCAAACACAATTGGTAATTTAA
GAAACCTTGAGTGGCTCGGCTTGGGTAATAACTACTTGACATCTTCAACC
TCAAAATTGAGCTTTCTTTCCTCTTTGGCAAATTGCAAGAAATTAAGAGA
CATAGGCTTAACAGGCAATCCACTCAACGGTATCCTTCCAAGTTCAATAG
GTAATCTTTCCATGTCTTTGAAAACACTTTACATCGGCAATTGCAGTATT
AGTGGCAACATTCCTCAATCAATTGGCAATTTAAGCAACTTATTGGCCTT
AGTATTAGAACTCAATAAATTGACTGGACCTATCCCAACTACATTCGGCC
GACTGCAGAAACTCCAAGGCTTATATCTTGCATTCAATAAGTTGGTAGGT
TCATTCCCAGATGAGCTTTGCCATCTAGGAAGGCTGGATAAATTGGTCTT
ATTTGGCAATAAGCTTTCAGGATCTATACCTTCATGCTTAAGTAATCTCA
CTTCTCTGAGATCTCTCTACTTAGGGTCCAATAGGTTTACTTCTGTCATT
CCCTCAACTTTCTGGAGCCTAAAAGACATCTTGTTCTTTGACTTTTCATC
AAATTTCTTGGTGGGTCCTCTTTCTTCAGACATAGGTAATTTGAAGGTGC
TTCTAGGAATAAATTTATCAGAAAATAACTTATCGGGTGATATGCCAGCC
ACAATTGGAGGACTGAAAGATCTTCAAATTATGGACCTAGCATATAATAG
ATTGGAAGGCCCANTNCTGNANNTCATTGTGACTTTGATAGTTTAGAAAG
TTTGAATTTGTCAAATATAAAATCTCCGGGTCTATTCCAAAATCCNTGGG
GAACTCTTTTACCTCGAGAAGTAATCTCTCTTTCATGAACTAGAAGTGAG
ATTCTAGTGGAGAATTTT
back to top