EY659273

Overview
NameEY659273
Unique NameEY659273
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length851
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
EY659273_ssr18 microsatellite EY659273_ssr18:18..37. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of EY659273 vs. ExPASy Swiss-Prot
Match: NDRG1_BOVIN (Protein NDRG1 OS=Bos taurus GN=NDRG1 PE=2 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 7.253e-21
Identity = 58/179 (32.40%), Postives = 98/179 (54.75%), Query Frame = 3
Query:  114 IKTSHGSLSVTIYGDQ--DKPALVTYPDLALNYMSCFQGLFFCPEACSLLLHNFCIYHINPPGHEFGAAAISDDEPVLSVDDLADQIAEVLNHFGLGAVMCMGVTAGAYILTLFAMKYRHRVLGLILVSPLCKAPSWTEWLYNKVMSNLLYYYGMCGVVKELLLKRYFSK-EVRGNAQV 641
            I+T HGS+ VT+ G    ++P ++TY D+ +N+ +C+  LF   +   +  H F + H++ PG + GAA+        S+D LA+ +  VL  FGL +++ MG  AGAYILT FA+     V GL+L++    A  W +W  +K+        G    + ++++   F K E++ N +V
Sbjct:   37 IETLHGSIHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNSEDMQEITQH-FAVCHVDAPGQQDGAASFPTGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKIS-------GWTQALPDMVVSHLFGKEEMQNNVEV 207          
BLAST of EY659273 vs. ExPASy Swiss-Prot
Match: NDR1B_XENLA (Protein NDRG1-B OS=Xenopus laevis GN=ndrg1-B PE=2 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 9.473e-21
Identity = 58/182 (31.87%), Postives = 100/182 (54.95%), Query Frame = 3
Query:  114 IKTSHGSLSVTIYGDQ--DKPALVTYPDLALNYMSCFQGLFFCPEACSLLLHNFCIYHINPPGHEFGAAAISDDEPVLSVDDLADQIAEVLNHFGLGAVMCMGVTAGAYILTLFAMKYRHRVLGLILVSPLCKAPSWTEWLYNKVMSNLLYYYGMCGVVKELLLKRYFSK-EVRGNAQVPES 650
            I+T+HG + VT+ G    ++P ++TY D+ LN+ +CF  LF   +   +  H F + H++ PG + GAA+        S+D LA+ +  V+   GL +++ +G+ +GAYILT FA+ +   V GL+L++    A  W +W   K+        G    + E+++   FSK EV  N ++ E+
Sbjct:   38 IETAHGIVHVTMCGTPKLNRPVILTYHDIGLNHKTCFNSLFNFEDMHEITQH-FSVCHVDAPGQQEGAASFPAGYMYPSMDQLAEMLPGVVQQLGLKSIIGLGIGSGAYILTRFALNHPSMVEGLVLININPCAEGWMDWAATKIS-------GWAHALPEMVISHLFSKDEVHSNPELVET 211          
BLAST of EY659273 vs. ExPASy Swiss-Prot
Match: NDRG1_HUMAN (Protein NDRG1 OS=Homo sapiens GN=NDRG1 PE=1 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 1.616e-20
Identity = 58/179 (32.40%), Postives = 98/179 (54.75%), Query Frame = 3
Query:  114 IKTSHGSLSVTIYGDQ--DKPALVTYPDLALNYMSCFQGLFFCPEACSLLLHNFCIYHINPPGHEFGAAAISDDEPVLSVDDLADQIAEVLNHFGLGAVMCMGVTAGAYILTLFAMKYRHRVLGLILVSPLCKAPSWTEWLYNKVMSNLLYYYGMCGVVKELLLKRYFSK-EVRGNAQV 641
            I+T HGS+ VT+ G    ++P ++TY D+ +N+ +C+  LF   +   +  H F + H++ PG + GAA+        S+D LA+ +  VL  FGL +++ MG  AGAYILT FA+     V GL+L++    A  W +W  +K+        G    + ++++   F K E++ N +V
Sbjct:   37 IETLHGSVHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNYEDMQEITQH-FAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKIS-------GWTQALPDMVVSHLFGKEEMQSNVEV 207          
BLAST of EY659273 vs. ExPASy Swiss-Prot
Match: NDRG1_MOUSE (Protein NDRG1 OS=Mus musculus GN=Ndrg1 PE=1 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 2.110e-20
Identity = 59/179 (32.96%), Postives = 97/179 (54.19%), Query Frame = 3
Query:  114 IKTSHGSLSVTIYGDQ--DKPALVTYPDLALNYMSCFQGLFFCPEACSLLLHNFCIYHINPPGHEFGAAAISDDEPVLSVDDLADQIAEVLNHFGLGAVMCMGVTAGAYILTLFAMKYRHRVLGLILVSPLCKAPSWTEWLYNKVMSNLLYYYGMCGVVKELLLKRYFSK-EVRGNAQV 641
            I+T HGSL VT+ G    ++P ++TY D+ +N+ +C+  LF   +   +  H F + H++ PG + GA +        S+D LA+ +  VL+ FGL +V+ MG  AGAYILT FA+     V GL+L++    A  W +W  +K+        G    + ++++   F K E+  N +V
Sbjct:   37 IETLHGSLHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNSEDMQEITQH-FAVCHVDAPGQQDGAPSFPVGYMYPSMDQLAEMLPGVLHQFGLKSVIGMGTGAGAYILTRFALNNPEMVEGLVLMNVNPCAEGWMDWAASKIS-------GWTQALPDMVVSHLFGKEEIHNNVEV 207          
BLAST of EY659273 vs. ExPASy Swiss-Prot
Match: NDRG1_MACFA (Protein NDRG1 OS=Macaca fascicularis GN=Ndrg1 PE=2 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 2.110e-20
Identity = 58/179 (32.40%), Postives = 97/179 (54.19%), Query Frame = 3
Query:  114 IKTSHGSLSVTIYGDQ--DKPALVTYPDLALNYMSCFQGLFFCPEACSLLLHNFCIYHINPPGHEFGAAAISDDEPVLSVDDLADQIAEVLNHFGLGAVMCMGVTAGAYILTLFAMKYRHRVLGLILVSPLCKAPSWTEWLYNKVMSNLLYYYGMCGVVKELLLKRYFSK-EVRGNAQV 641
            I+T HGS+ VT+ G    ++P ++TY D+ +N+ +C+  LF   +   +  H F + H++ PG + GAA+        S+D LA+ +  VL  FGL +++ MG  AGAYILT FA+     V GL+L++    A  W +W  +K+        G    + ++++   F K E+  N +V
Sbjct:   37 IETLHGSVHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNYEDMQEITQH-FAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKIS-------GWTQALPDMVVSHLFGKEEMHSNVEV 207          
BLAST of EY659273 vs. ExPASy Swiss-Prot
Match: NDRG3_BOVIN (Protein NDRG3 OS=Bos taurus GN=NDRG3 PE=2 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 2.756e-20
Identity = 56/171 (32.75%), Postives = 96/171 (56.14%), Query Frame = 3
Query:  114 IKTSHGSLSVTIYG--DQDKPALVTYPDLALNYMSCFQGLFFCPEACSLLLHNFCIYHINPPGHEFGAAAISDDEPVLSVDDLADQIAEVLNHFGLGAVMCMGVTAGAYILTLFAMKYRHRVLGLILVSPLCKAPSWTEWLYNKVMSNLLYYYGMCGVVKELLLKRYFSKE 620
            I+T+HG + VTI G    ++P ++TY D+ LN+ SCF   FF  E    +  +F + H++ PG + GA +        ++D+LA+ +  VL H  L +++ +GV AGAYIL+ FA+ +   V GL+L++    A  W +W  +K+        G+   V +++L  +F +E
Sbjct:   35 IETAHGMVHVTIRGLPKGNRPVILTYHDIGLNHKSCFNA-FFNFEDMQEITQHFAVCHVDAPGQQEGAPSFPTGYQYPTMDELAEMLPPVLTHLNLKSIIGIGVGAGAYILSRFALNHPELVEGLVLINVDPCAKGWIDWAASKLS-------GLTTNVVDIILSHHFGQE 197          
BLAST of EY659273 vs. ExPASy Swiss-Prot
Match: NDRG1_RAT (Protein NDRG1 OS=Rattus norvegicus GN=Ndrg1 PE=1 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 2.756e-20
Identity = 59/179 (32.96%), Postives = 97/179 (54.19%), Query Frame = 3
Query:  114 IKTSHGSLSVTIYGDQ--DKPALVTYPDLALNYMSCFQGLFFCPEACSLLLHNFCIYHINPPGHEFGAAAISDDEPVLSVDDLADQIAEVLNHFGLGAVMCMGVTAGAYILTLFAMKYRHRVLGLILVSPLCKAPSWTEWLYNKVMSNLLYYYGMCGVVKELLLKRYFSK-EVRGNAQV 641
            I+T HGSL VT+ G    ++P ++TY D+ +N+ +C+  LF   +   +  H F + H++ PG + GA +        S+D LA+ +  VL+ FGL +V+ MG  AGAYILT FA+     V GL+L++    A  W +W  +K+        G    + ++++   F K E+  N +V
Sbjct:   37 IETLHGSLHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNSEDMQEITQH-FAVCHVDAPGQQDGAPSFPVGYMYPSMDQLAEMLPGVLHKFGLKSVIGMGTGAGAYILTRFALNNPEMVEGLVLMNVNPCAEGWMDWAASKIS-------GWTQALPDMVVSHLFGKEEIHSNVEV 207          
BLAST of EY659273 vs. ExPASy Swiss-Prot
Match: NDRG3_PONAB (Protein NDRG3 OS=Pongo abelii GN=NDRG3 PE=2 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 3.600e-20
Identity = 56/171 (32.75%), Postives = 96/171 (56.14%), Query Frame = 3
Query:  114 IKTSHGSLSVTIYG--DQDKPALVTYPDLALNYMSCFQGLFFCPEACSLLLHNFCIYHINPPGHEFGAAAISDDEPVLSVDDLADQIAEVLNHFGLGAVMCMGVTAGAYILTLFAMKYRHRVLGLILVSPLCKAPSWTEWLYNKVMSNLLYYYGMCGVVKELLLKRYFSKE 620
            I+T+HG + VTI G    ++P ++TY D+ LN+ SCF   FF  E    +  +F + H++ PG + GA +        ++D+LA+ +  VL H  L +++ +GV AGAYIL+ FA+ +   V GL+L++    A  W +W  +K+        G+   V +++L  +F +E
Sbjct:   35 IETTHGMVHVTIRGLPKGNRPVILTYHDIGLNHKSCFNA-FFNFEDMQEITQHFAVCHVDAPGQQEGAPSFPTGYQYPTMDELAEMLPPVLTHLSLKSIIGIGVGAGAYILSRFALNHPELVEGLVLINVDPCAKGWIDWAASKLS-------GLTTNVVDIILAHHFGQE 197          
BLAST of EY659273 vs. ExPASy Swiss-Prot
Match: NDRG3_HUMAN (Protein NDRG3 OS=Homo sapiens GN=NDRG3 PE=1 SV=2)

HSP 1 Score: 98.5969 bits (244), Expect = 4.701e-20
Identity = 56/171 (32.75%), Postives = 96/171 (56.14%), Query Frame = 3
Query:  114 IKTSHGSLSVTIYG--DQDKPALVTYPDLALNYMSCFQGLFFCPEACSLLLHNFCIYHINPPGHEFGAAAISDDEPVLSVDDLADQIAEVLNHFGLGAVMCMGVTAGAYILTLFAMKYRHRVLGLILVSPLCKAPSWTEWLYNKVMSNLLYYYGMCGVVKELLLKRYFSKE 620
            I+T+HG + VTI G    ++P ++TY D+ LN+ SCF   FF  E    +  +F + H++ PG + GA +        ++D+LA+ +  VL H  L +++ +GV AGAYIL+ FA+ +   V GL+L++    A  W +W  +K+        G+   V +++L  +F +E
Sbjct:   35 IETTHGVVHVTIRGLPKGNRPVILTYHDIGLNHKSCFNA-FFNFEDMQEITQHFAVCHVDAPGQQEGAPSFPTGYQYPTMDELAEMLPPVLTHLSLKSIIGIGVGAGAYILSRFALNHPELVEGLVLINVDPCAKGWIDWAASKLS-------GLTTNVVDIILAHHFGQE 197          
BLAST of EY659273 vs. ExPASy Swiss-Prot
Match: NDR4A_XENLA (Protein NDRG4-A OS=Xenopus laevis GN=ndrg4-A PE=2 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 4.701e-20
Identity = 56/193 (29.02%), Postives = 98/193 (50.78%), Query Frame = 3
Query:   48 DSSSDSVSIDMETPPPSGKDNLIKTSHGSLSVTIYGDQ--DKPALVTYPDLALNYMSCFQGLFFCPEACSLLLHNFCIYHINPPGHEFGAAAISDDEPVLSVDDLADQIAEVLNHFGLGAVMCMGVTAGAYILTLFAMKYRHRVLGLILVSPLCKAPSWTEWLYNKVMSNLLYYYGMCGVVKELLLKRYFSKE 620
            D+  +S    +       K++ I+T +G L V I G    ++PA++TY D+ LN+  CF   FF  E    +  +F + H++ PG + GA+         ++D LA  +  V+ HFG  +++ +GV AGAY+L  FA+ +   V G++L++       W +W  +K+        G+   + E +L   FS+E
Sbjct:   40 DTEMESADTFLSAADTDWKEHDIETPYGMLHVVIRGTPKGNRPAILTYHDVGLNHKLCFN-TFFNYEDMQEITKHFVVCHVDAPGQQVGASQFPQGYQYPTMDQLAAMLPSVMQHFGFQSIIAIGVGAGAYVLAKFALIFPELVEGMVLINIDPNGKGWIDWAASKIS-------GLASSLPETVLSHLFSQE 224          
The following BLAST results are available for this feature:
BLAST of EY659273 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 33
Match NameE-valueIdentityDescription
NDRG1_BOVIN7.253e-2132.40Protein NDRG1 OS=Bos taurus GN=NDRG1 PE=2 SV=1[more]
NDR1B_XENLA9.473e-2131.87Protein NDRG1-B OS=Xenopus laevis GN=ndrg1-B PE=2 ... [more]
NDRG1_HUMAN1.616e-2032.40Protein NDRG1 OS=Homo sapiens GN=NDRG1 PE=1 SV=1[more]
NDRG1_MOUSE2.110e-2032.96Protein NDRG1 OS=Mus musculus GN=Ndrg1 PE=1 SV=1[more]
NDRG1_MACFA2.110e-2032.40Protein NDRG1 OS=Macaca fascicularis GN=Ndrg1 PE=2... [more]
NDRG3_BOVIN2.756e-2032.75Protein NDRG3 OS=Bos taurus GN=NDRG3 PE=2 SV=1[more]
NDRG1_RAT2.756e-2032.96Protein NDRG1 OS=Rattus norvegicus GN=Ndrg1 PE=1 S... [more]
NDRG3_PONAB3.600e-2032.75Protein NDRG3 OS=Pongo abelii GN=NDRG3 PE=2 SV=1[more]
NDRG3_HUMAN4.701e-2032.75Protein NDRG3 OS=Homo sapiens GN=NDRG3 PE=1 SV=2[more]
NDR4A_XENLA4.701e-2029.02Protein NDRG4-A OS=Xenopus laevis GN=ndrg4-A PE=2 ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-008-C10-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659273 ID=EY659273|Name=EY659273|organism=Citrus sinensis|type=EST|length=851bp
AGAAGAGTAGAGAGAGAAGAGAGAGAGAGAGAGAGAGAAAGATGGCAGAT
TCTTCAAGCGATTCGGTTTCCATTGATATGGAGACTCCTCCTCCTAGTGG
CAAGGACAATCTTATAAAAACTTCCCATGGTTCTTTGTCTGTTACCATCT
ATGGGGACCAGGACAAGCCAGCTCTTGTCACTTATCCTGATTTAGCTCTA
AACTATATGTCCTGCTTTCAAGGATTATTCTTCTGCCCAGAAGCATGTTC
CTTGCTACTGCACAACTTTTGCATATATCATATAAATCCTCCTGGCCACG
AGTTTGGAGCTGCGGCAATTAGTGATGATGAACCTGTACTCTCTGTTGAT
GATTTAGCGGATCAAATCGCTGAGGTTCTTAACCATTTTGGACTTGGTGC
AGTGATGTGTATGGGGGTTACAGCTGGAGCTTACATTCTTACACTATTTG
CTATGAAATATAGGCACCGTGTACTTGGGTTAATCCTAGTTTCTCCTCTG
TGCAAAGCACCCTCTTGGACAGAATGGTTGTATAATAAGGTAATGTCAAA
TTTACTCTACTACTATGGCATGTGTGGGGTGGTGAAGGAATTATTGCTAA
AGCGGTACTTCAGCAAGGAAGTTCGTGGTAATGCCCAAGTACCAGAATCT
GATATAGTTCAGGCATGCAGAAGACTGCTGGATGAAAGACAGAGCTCANN
ATGTTGGCATTTTCTTGAAGCATTAATGGGAGACCCGACATCAGCGAAGG
GNCTGCGGAACTGNCATGCCGCTCTCTAATATTGNTGGTGAAAGCTCTNC
TTNCATTNCTGAGCTGTCACATGACTTCTAAAATGATAGAAAAATANTGC
T
back to top