EY659273

Overview
NameEY659273
Unique NameEY659273
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length851
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
EY659273_ssr18 microsatellite EY659273_ssr18:18..37. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of EY659273 vs. ExPASy Swiss-Prot
Match: NDRG4_XENTR (Protein NDRG4 OS=Xenopus tropicalis GN=ndrg4 PE=2 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 5.198e-19
Identity = 56/193 (29.02%), Postives = 98/193 (50.78%), Query Frame = 3
Query:   48 DSSSDSVSIDMETPPPSGKDNLIKTSHGSLSVTIYGDQ--DKPALVTYPDLALNYMSCFQGLFFCPEACSLLLHNFCIYHINPPGHEFGAAAISDDEPVLSVDDLADQIAEVLNHFGLGAVMCMGVTAGAYILTLFAMKYRHRVLGLILVSPLCKAPSWTEWLYNKVMSNLLYYYGMCGVVKELLLKRYFSKE 620
            D+  +S    +       K++ I+T +G L V I G    ++PA++TY D+ LN+  CF   FF  E    +  +F + H++ PG + GA+         +++ LA  +  V+ HFG  +++ +GV AGAY+L  FA+ +   V G++LV+       W +W  +K+        G+   + E +L   FS+E
Sbjct:   40 DTEMESADTFLSAADTDWKEHDIETPYGMLHVVIRGTPKGNRPAILTYHDVGLNHKLCFN-TFFNYEDMQEITKHFVVCHVDAPGQQVGASQFPQGYQYPTMEQLAAMLPSVMQHFGFQSIIGIGVGAGAYVLAKFALIFPELVEGMVLVNIDPNGKGWIDWAASKLS-------GLTSSLPETVLSHLFSQE 224          
BLAST of EY659273 vs. ExPASy Swiss-Prot
Match: NDRG3_RAT (Protein NDRG3 OS=Rattus norvegicus GN=Ndrg3 PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 8.867e-19
Identity = 54/171 (31.58%), Postives = 94/171 (54.97%), Query Frame = 3
Query:  114 IKTSHGSLSVTIYG--DQDKPALVTYPDLALNYMSCFQGLFFCPEACSLLLHNFCIYHINPPGHEFGAAAISDDEPVLSVDDLADQIAEVLNHFGLGAVMCMGVTAGAYILTLFAMKYRHRVLGLILVSPLCKAPSWTEWLYNKVMSNLLYYYGMCGVVKELLLKRYFSKE 620
            I+T HG + VTI G    ++P ++TY D+ LN+ SCF   FF  E    +  +F + H++ PG +  A +        ++D+LA+ +  VL H  + +++ +GV AGAYIL+ FA+ +   V GL+L++    A  W +W  +K+        G+   V +++L  +F +E
Sbjct:   35 IETPHGMVHVTIRGLPKGNRPVILTYHDIGLNHKSCFN-TFFNFEDMQEITQHFAVCHVDAPGQQEAAPSFPTGYQYPTMDELAEMLPPVLTHLSMKSIIGIGVGAGAYILSRFALNHPELVEGLVLINIDPCAKGWIDWAASKLS-------GLTTNVVDIILAHHFGQE 197          
BLAST of EY659273 vs. ExPASy Swiss-Prot
Match: NDRG2_XENTR (Protein NDRG2 OS=Xenopus tropicalis GN=ndrg2 PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 8.867e-19
Identity = 56/179 (31.28%), Postives = 97/179 (54.19%), Query Frame = 3
Query:  114 IKTSHGSLSVTIYGDQD--KPALVTYPDLALNYMSCFQGLFFCPEACSLLLHNFCIYHINPPGHEFGAAAISDDEPVLSVDDLADQIAEVLNHFGLGAVMCMGVTAGAYILTLFAMKYRHRVLGLILVSPLCKAPSWTEWLYNKVMSNLLYYYGMCGVVKELLLKRYFS-KEVRGNAQV 641
            I+T +G ++VTI G     +PA+VT+ D+ +++  CF  LF   + C ++  NF + HI+ PG E G+A         S+D LA+ I  VL +    +++ +GV AGAYI   + + + + V GL+L++    A  W +W   K+        G+   + +++L   FS +E+ GN+ V
Sbjct:   39 IETPYGVVTVTIQGTPKPKRPAIVTFHDVGMDHKMCFDTLFKYEDMCEIV-KNFVVCHIDAPGQEEGSAVYPPGYQYPSLDQLAETIPCVLQYLNFPSIIGIGVGAGAYIFAKYTLSHANTVEGLVLINIDPNAKGWMDWAAQKLT-------GLTQSISDMMLGHLFSAEELSGNSDV 209          
BLAST of EY659273 vs. ExPASy Swiss-Prot
Match: NDR4B_XENLA (Protein NDRG4-B OS=Xenopus laevis GN=ndrg4-B PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 8.867e-19
Identity = 55/193 (28.50%), Postives = 97/193 (50.26%), Query Frame = 3
Query:   48 DSSSDSVSIDMETPPPSGKDNLIKTSHGSLSVTIYGDQ--DKPALVTYPDLALNYMSCFQGLFFCPEACSLLLHNFCIYHINPPGHEFGAAAISDDEPVLSVDDLADQIAEVLNHFGLGAVMCMGVTAGAYILTLFAMKYRHRVLGLILVSPLCKAPSWTEWLYNKVMSNLLYYYGMCGVVKELLLKRYFSKE 620
            D+  +S    M       K++ I+T +G L V I G    ++PA++TY D+ LN+  CF   FF  E    +  +F + H++ PG + GA+         +++ LA  +  V+ HFG  +++ +GV AGAY+   FA+ +   V G++L++       W +W  +K+        G+   + E +L   FS+E
Sbjct:   17 DTEMESADTFMSAADTDWKEHDIETPYGMLHVVIRGTPKGNRPAILTYHDVGLNHKLCFN-TFFNYEDMQEITKHFVVCHVDAPGQQVGASQFPQGYQYPTMEQLAAMLPSVMQHFGFQSIIGIGVGAGAYVFAKFALIFPELVEGMVLINIDPNGKGWIDWAASKLS-------GLTSSLPETVLSHLFSQE 201          
BLAST of EY659273 vs. ExPASy Swiss-Prot
Match: NDRG2_DANRE (Protein NDRG2 OS=Danio rerio GN=ndrg2 PE=2 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 1.158e-18
Identity = 54/154 (35.06%), Postives = 87/154 (56.49%), Query Frame = 3
Query:   99 GKDNLIKTSHGSLSVTIYGDQD--KPALVTYPDLALNYMSCFQGLFFCPEACSLLLHNFCIYHINPPGHEFGAAAISDDEPVLSVDDLADQIAEVLNHFGLGAVMCMGVTAGAYILTLFAMKYRHRVLGLILVSPLCKAPSWTEWLYNKVMSNL 554
            G+++ ++T HG L VT++G  +  +PA++T  D+ ++  SCF  LF   E   ++  NF + HI+ PG E GAA         S+D +++ +  VL  F    ++ +GV AGAYIL+ F +     V GL+LV+    A  W +W  +K +SNL
Sbjct:   38 GQEHTVETPHGVLHVTVHGSGNARRPAILTIHDVGMDSKSCFSTLFRFEEMQEIV-KNFTVVHIDAPGQEEGAAVYPAGYQYASMDQVSEMLPAVLQFFNFRTIIGVGVGAGAYILSRFTLNNPEAVEGLVLVNVDPNARGWMDWAAHK-LSNL 189          
BLAST of EY659273 vs. ExPASy Swiss-Prot
Match: NDRG3_MOUSE (Protein NDRG3 OS=Mus musculus GN=Ndrg3 PE=1 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.975e-18
Identity = 53/171 (30.99%), Postives = 93/171 (54.39%), Query Frame = 3
Query:  114 IKTSHGSLSVTIYG--DQDKPALVTYPDLALNYMSCFQGLFFCPEACSLLLHNFCIYHINPPGHEFGAAAISDDEPVLSVDDLADQIAEVLNHFGLGAVMCMGVTAGAYILTLFAMKYRHRVLGLILVSPLCKAPSWTEWLYNKVMSNLLYYYGMCGVVKELLLKRYFSKE 620
            I+T HG + VTI G    ++P ++TY D+ LN+ SCF   FF  E    +  +F + H++ PG +  A +        ++D+LA+ +  VL H  + +++ +GV AGAYIL+ FA+ +   V GL+L++    A  W +W  +K+        G    + +++L  +F +E
Sbjct:   35 IETPHGMVHVTIRGLPKGNRPVILTYHDIGLNHKSCFN-TFFNFEDMQEITQHFAVCHVDAPGQQEAAPSFPTGYQYPTMDELAEMLPPVLTHLSMKSIIGIGVGAGAYILSRFALNHPELVEGLVLINIDPCAKGWIDWAASKLS-------GFTTNIVDIILAHHFGQE 197          
BLAST of EY659273 vs. ExPASy Swiss-Prot
Match: NDRG4_RAT (Protein NDRG4 OS=Rattus norvegicus GN=Ndrg4 PE=2 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 2.580e-18
Identity = 58/189 (30.69%), Postives = 97/189 (51.32%), Query Frame = 3
Query:  114 IKTSHGSLSVTIYGDQ--DKPALVTYPDLALNYMSCFQGLFFCPEACSLLLHNFCIYHINPPGHEFGAAAISDDEPVLSVDDLADQIAEVLNHFGLGAVMCMGVTAGAYILTLFAMKYRHRVLGLILVSPLCKAPSWTEWLYNKVMSNLLYYYGMCGVVKELLLKRYFSKEVRGNAQVPESDIVQACRR 674
            I+T +G L V I G    ++PA++TY D+ LN+  CF  LF   +   +  H F + H++ PG + GA+         S++ LA  +  V+ HFG   V+ +GV AGAY+L  FA+ +   V GL+L++       W +W   K+        G+   + + +L   FS+E      V  +++VQ+ R+
Sbjct:   11 IETPYGLLHVVIRGSPKGNRPAILTYHDVGLNHKLCFNTLFNLEDMQEITKH-FVVCHVDAPGQQVGASQFPQGYQFPSMEQLATMLPNVVQHFGFKYVIGIGVGAGAYVLAKFALIFPDLVEGLVLMNIDPNGKGWIDWAATKLS-------GLTSTLPDTVLSHLFSQE----ELVNNTELVQSYRQ 187          
BLAST of EY659273 vs. ExPASy Swiss-Prot
Match: NDRG2_XENLA (Protein NDRG2 OS=Xenopus laevis GN=ndrg2 PE=2 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 2.580e-18
Identity = 56/179 (31.28%), Postives = 95/179 (53.07%), Query Frame = 3
Query:  114 IKTSHGSLSVTIYGDQD--KPALVTYPDLALNYMSCFQGLFFCPEACSLLLHNFCIYHINPPGHEFGAAAISDDEPVLSVDDLADQIAEVLNHFGLGAVMCMGVTAGAYILTLFAMKYRHRVLGLILVSPLCKAPSWTEWLYNKVMSNLLYYYGMCGVVKELLLKRYFS-KEVRGNAQV 641
            I+T +G ++VTI G     +PA+VT+ D+ +++  CF  LF   + C ++  NF + HI+ PG E GA          S+D LA+ I  VL +    +++ +GV AGAYI   + + + + V GL+L++    A  W +W   K+        G+   + + +L   FS +E+ GN+ V
Sbjct:   39 IETPYGVVTVTIQGTPKPKRPAIVTFHDVGMDHKMCFDTLFKYEDMCEIV-KNFVVCHIDAPGQEDGATIYPPGYQYPSLDQLAETIPCVLQYLNFPSIIGIGVGAGAYIFAKYTLSHANTVEGLVLINIDPNAKGWMDWAAQKLT-------GLTQSISDKMLGHLFSAEEISGNSDV 209          
BLAST of EY659273 vs. ExPASy Swiss-Prot
Match: NDRG4_HUMAN (Protein NDRG4 OS=Homo sapiens GN=NDRG4 PE=2 SV=2)

HSP 1 Score: 92.0485 bits (227), Expect = 4.400e-18
Identity = 59/189 (31.22%), Postives = 97/189 (51.32%), Query Frame = 3
Query:  114 IKTSHGSLSVTIYGDQ--DKPALVTYPDLALNYMSCFQGLFFCPEACSLLLHNFCIYHINPPGHEFGAAAISDDEPVLSVDDLADQIAEVLNHFGLGAVMCMGVTAGAYILTLFAMKYRHRVLGLILVSPLCKAPSWTEWLYNKVMSNLLYYYGMCGVVKELLLKRYFSKEVRGNAQVPESDIVQACRR 674
            I+T +G L V I G    ++PA++TY D+ LN+  CF   FF  E    +  +F + H++ PG + GA+         S++ LA  +  V+ HFG   V+ +GV AGAY+L  FA+ +   V GL+LV+       W +W   K+        G+   + + +L   FS+E      V  +++VQ+ R+
Sbjct:   11 IETPYGLLHVVIRGSPKGNRPAILTYHDVGLNHKLCFN-TFFNFEDMQEITKHFVVCHVDAPGQQVGASQFPQGYQFPSMEQLAAMLPSVVQHFGFKYVIGIGVGAGAYVLAKFALIFPDLVEGLVLVNIDPNGKGWIDWAATKLS-------GLTSTLPDTVLSHLFSQE----ELVNNTELVQSYRQ 187          
BLAST of EY659273 vs. ExPASy Swiss-Prot
Match: NDRG3_XENTR (Protein NDRG3 OS=Xenopus tropicalis GN=ndrg3 PE=2 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 4.400e-18
Identity = 57/193 (29.53%), Postives = 105/193 (54.40%), Query Frame = 3
Query:   99 GKDNLIKTSHGSLSVTIYGDQ--DKPALVTYPDLALNYMSCFQGLFFCPEACSLLLHNFCIYHINPPGHEFGAAAISDDEPVLSVDDLADQIAEVLNHFGLGAVMCMGVTAGAYILTLFAMKYRHRVLGLILVSPLCKAPSWTEWLYNKVMSNLLYYYGMCGVVKELLLKRYFSKEVRGNAQVPESDIVQACR 671
            G+++ I+T+ G + VT+ G+   ++P L+T+ D+ LN+ SCF   F   +   +  H F + HI+ PG + GA +        ++D+LA+ +  VL H  L +++ +GV AGAY+L+ FA+     V GL+L++    A  W +W  +K+       +    +V+ +L + +  +E++ N      D+VQ  R
Sbjct:   30 GQEHNIETAFGVVHVTMSGNARGNRPVLLTFHDIGLNHKSCFNSFFNFDDMHEITQH-FAVCHIDAPGQQEGAPSFPTGYQYPTMDELAEMLCAVLTHLNLRSIIGIGVGAGAYVLSRFALNNPLLVEGLVLINIDPCAKGWIDWAASKLS------FWTSNIVEIVLGQLFGDEELQSNL-----DLVQTYR 210          
The following BLAST results are available for this feature:
BLAST of EY659273 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 33
Match NameE-valueIdentityDescription
NDRG4_XENTR5.198e-1929.02Protein NDRG4 OS=Xenopus tropicalis GN=ndrg4 PE=2 ... [more]
NDRG3_RAT8.867e-1931.58Protein NDRG3 OS=Rattus norvegicus GN=Ndrg3 PE=2 S... [more]
NDRG2_XENTR8.867e-1931.28Protein NDRG2 OS=Xenopus tropicalis GN=ndrg2 PE=2 ... [more]
NDR4B_XENLA8.867e-1928.50Protein NDRG4-B OS=Xenopus laevis GN=ndrg4-B PE=2 ... [more]
NDRG2_DANRE1.158e-1835.06Protein NDRG2 OS=Danio rerio GN=ndrg2 PE=2 SV=1[more]
NDRG3_MOUSE1.975e-1830.99Protein NDRG3 OS=Mus musculus GN=Ndrg3 PE=1 SV=1[more]
NDRG4_RAT2.580e-1830.69Protein NDRG4 OS=Rattus norvegicus GN=Ndrg4 PE=2 S... [more]
NDRG2_XENLA2.580e-1831.28Protein NDRG2 OS=Xenopus laevis GN=ndrg2 PE=2 SV=1[more]
NDRG4_HUMAN4.400e-1831.22Protein NDRG4 OS=Homo sapiens GN=NDRG4 PE=2 SV=2[more]
NDRG3_XENTR4.400e-1829.53Protein NDRG3 OS=Xenopus tropicalis GN=ndrg3 PE=2 ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-008-C10-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659273 ID=EY659273|Name=EY659273|organism=Citrus sinensis|type=EST|length=851bp
AGAAGAGTAGAGAGAGAAGAGAGAGAGAGAGAGAGAGAAAGATGGCAGAT
TCTTCAAGCGATTCGGTTTCCATTGATATGGAGACTCCTCCTCCTAGTGG
CAAGGACAATCTTATAAAAACTTCCCATGGTTCTTTGTCTGTTACCATCT
ATGGGGACCAGGACAAGCCAGCTCTTGTCACTTATCCTGATTTAGCTCTA
AACTATATGTCCTGCTTTCAAGGATTATTCTTCTGCCCAGAAGCATGTTC
CTTGCTACTGCACAACTTTTGCATATATCATATAAATCCTCCTGGCCACG
AGTTTGGAGCTGCGGCAATTAGTGATGATGAACCTGTACTCTCTGTTGAT
GATTTAGCGGATCAAATCGCTGAGGTTCTTAACCATTTTGGACTTGGTGC
AGTGATGTGTATGGGGGTTACAGCTGGAGCTTACATTCTTACACTATTTG
CTATGAAATATAGGCACCGTGTACTTGGGTTAATCCTAGTTTCTCCTCTG
TGCAAAGCACCCTCTTGGACAGAATGGTTGTATAATAAGGTAATGTCAAA
TTTACTCTACTACTATGGCATGTGTGGGGTGGTGAAGGAATTATTGCTAA
AGCGGTACTTCAGCAAGGAAGTTCGTGGTAATGCCCAAGTACCAGAATCT
GATATAGTTCAGGCATGCAGAAGACTGCTGGATGAAAGACAGAGCTCANN
ATGTTGGCATTTTCTTGAAGCATTAATGGGAGACCCGACATCAGCGAAGG
GNCTGCGGAACTGNCATGCCGCTCTCTAATATTGNTGGTGAAAGCTCTNC
TTNCATTNCTGAGCTGTCACATGACTTCTAAAATGATAGAAAAATANTGC
T
back to top