EY659268

Overview
NameEY659268
Unique NameEY659268
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length901
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig8110 contig Csv1_Contig8110:113..1014. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659268 vs. ExPASy Swiss-Prot
Match: CADH2_PICAB (Probable cinnamyl alcohol dehydrogenase 2 OS=Picea abies GN=CAD2 PE=3 SV=1)

HSP 1 Score: 223.787 bits (569), Expect = 5.490e-67
Identity = 107/201 (53.23%), Postives = 137/201 (68.16%), Query Frame = 3
Query:   39 EHPKNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSPLRFYGLXQPXXXXXXXXXXXXXXXXXKFAKLWGL 641
            E  K   G+AARD+SG LSP+ ++ R  G +DV  +V +CGICHSDL  + NE G + YP+VPGHE+VGVVTE+GS+V KFKVG+ VGVGC+VGSCRSC +C   +E YC K I TY    HDGT T GG++ +MV D+ FVVRIPE  PL+  APLLCAG+TVYSP++ +G+ +P                 K AK +GL
Sbjct:    5 ESEKTVTGYAARDSSGHLSPYTYTLRNKGPEDVIVRVIYCGICHSDLVQMHNEMGMSNYPMVPGHEVVGVVTEIGSEVKKFKVGEHVGVGCIVGSCRSCSNCNGSMEQYCSKRIWTYNDVNHDGTPTQGGFASSMVVDQMFVVRIPENLPLEQAAPLLCAGVTVYSPMKHFGMTEPGKKCGILGLGGVGHMGVKIAKAFGL 205          

HSP 2 Score: 52.7582 bits (125), Expect = 5.490e-67
Identity = 26/68 (38.24%), Postives = 40/68 (58.82%), Query Frame = 1
Query:  697 GADSFLVSRDQDEMQAAMGHMDGIIDTVSAVHPLMPVIGTVKSQGKXCTXGAPEKH*SYQLPLLRGGK 900
            GAD++LVS+D ++MQ A   +D I+DT+   HPL P +  +K+ GK    G   +   +  PLL  G+
Sbjct:  225 GADAYLVSKDAEKMQEAAESLDYIMDTIPVAHPLEPYLALLKTNGKLVMLGVVPEPLHFVTPLLILGR 292          
BLAST of EY659268 vs. ExPASy Swiss-Prot
Match: CADH7_PICAB (Probable cinnamyl alcohol dehydrogenase 7/8 OS=Picea abies GN=CAD7 PE=2 SV=1)

HSP 1 Score: 222.631 bits (566), Expect = 1.217e-66
Identity = 106/201 (52.74%), Postives = 137/201 (68.16%), Query Frame = 3
Query:   39 EHPKNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSPLRFYGLXQPXXXXXXXXXXXXXXXXXKFAKLWGL 641
            E  +   G+AARD+SG LSP+ ++ R  G +DV  +V +CGICHSDL  + NE G + YP+VPGHE+VGVVTE+GS+V KFKVG+ VGVGC+VGSCRSC +C   +E YC K I TY    HDGT T GG++ +MV D+ FVVRIPE  PL+  APLLCAG+TVYSP++ +G+ +P                 K AK +GL
Sbjct:    5 ESERTVTGYAARDSSGHLSPYTYTLRNKGPEDVIVRVIYCGICHSDLVQMHNEMGMSNYPMVPGHEVVGVVTEIGSEVKKFKVGEHVGVGCIVGSCRSCSNCNGSMEQYCSKRIWTYNDVNHDGTPTQGGFASSMVVDQMFVVRIPENLPLEQAAPLLCAGVTVYSPMKHFGMTEPGKKCGILGLGGVGHMGVKIAKAFGL 205          

HSP 2 Score: 52.7582 bits (125), Expect = 1.217e-66
Identity = 26/68 (38.24%), Postives = 40/68 (58.82%), Query Frame = 1
Query:  697 GADSFLVSRDQDEMQAAMGHMDGIIDTVSAVHPLMPVIGTVKSQGKXCTXGAPEKH*SYQLPLLRGGK 900
            GAD++LVS+D ++MQ A   +D I+DT+   HPL P +  +K+ GK    G   +   +  PLL  G+
Sbjct:  225 GADAYLVSKDAEKMQEAAESLDYIMDTIPVAHPLEPYLALLKTNGKLVMLGVVPEPLHFVTPLLILGR 292          
BLAST of EY659268 vs. ExPASy Swiss-Prot
Match: CADH3_ARATH (Cinnamyl alcohol dehydrogenase 3 OS=Arabidopsis thaliana GN=CAD3 PE=1 SV=1)

HSP 1 Score: 253.447 bits (646), Expect = 1.251e-66
Identity = 112/168 (66.67%), Postives = 134/168 (79.76%), Query Frame = 3
Query:   54 AFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSPLRFYGL 557
            AFGWAA D SGVLSPFHFSRR  GE DVT K+  CG+CHSDLH IKN WG + YPI+PGHEIVG+ T+VG  V+KFK GD+VGVG ++GSC+SC+SC  DLENYCPKV+ TY S+  DGT   GGYSD +V D  FV+ IP+G P D+ APLLCAGITVYSP+++YG+
Sbjct:    7 AFGWAANDESGVLSPFHFSRRENGENDVTVKILFCGVCHSDLHTIKNHWGFSRYPIIPGHEIVGIATKVGKNVTKFKEGDRVGVGVIIGSCQSCESCNQDLENYCPKVVFTYNSRSSDGTRNQGGYSDVIVVDHRFVLSIPDGLPSDSGAPLLCAGITVYSPMKYYGM 174          
BLAST of EY659268 vs. ExPASy Swiss-Prot
Match: CADH_PINRA (Probable cinnamyl alcohol dehydrogenase OS=Pinus radiata GN=CAD PE=2 SV=1)

HSP 1 Score: 221.861 bits (564), Expect = 7.806e-66
Identity = 105/201 (52.24%), Postives = 137/201 (68.16%), Query Frame = 3
Query:   39 EHPKNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSPLRFYGLXQPXXXXXXXXXXXXXXXXXKFAKLWGL 641
            E  K   G+AARD+SG LSP+ ++ R  G +DV  KV +CGICHSDL  ++NE G + YP+VPGHE+VG+VTE+GS+V KFKVG+ VGVGC+VGSCRSC +C   +E YC K I TY    HDGT T GG++ +MV D+ FVVRIPE  PL+  APLLCAG+TV+SP++ + + +P                 K AK +GL
Sbjct:    5 ETEKTVTGYAARDSSGHLSPYTYNLRKKGPEDVIVKVIYCGICHSDLVQMRNEMGMSHYPMVPGHEVVGIVTEIGSEVKKFKVGEHVGVGCIVGSCRSCGNCNQSMEQYCSKRIWTYNDVNHDGTPTQGGFASSMVVDQMFVVRIPENLPLEQAAPLLCAGVTVFSPMKHFAMTEPGKKCGILGLGGVGHMGVKIAKAFGL 205          

HSP 2 Score: 50.8322 bits (120), Expect = 7.806e-66
Identity = 25/68 (36.76%), Postives = 39/68 (57.35%), Query Frame = 1
Query:  697 GADSFLVSRDQDEMQAAMGHMDGIIDTVSAVHPLMPVIGTVKSQGKXCTXGAPEKH*SYQLPLLRGGK 900
            GAD++LVS+D ++M  A   +D I+DT+   HPL P +  +K+ GK    G   +   +  PLL  G+
Sbjct:  225 GADAYLVSKDTEKMMEAAESLDYIMDTIPVAHPLEPYLALLKTNGKLVMLGVVPEPLHFVTPLLILGR 292          
BLAST of EY659268 vs. ExPASy Swiss-Prot
Match: CADH_PINTA (Probable cinnamyl alcohol dehydrogenase OS=Pinus taeda PE=2 SV=1)

HSP 1 Score: 222.246 bits (565), Expect = 2.257e-65
Identity = 105/201 (52.24%), Postives = 137/201 (68.16%), Query Frame = 3
Query:   39 EHPKNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSPLRFYGLXQPXXXXXXXXXXXXXXXXXKFAKLWGL 641
            E  K   G+AARD+SG LSP+ ++ R  G +DV  KV +CGICHSDL  ++NE G + YP+VPGHE+VG+VTE+GS+V KFKVG+ VGVGC+VGSCRSC +C   +E YC K I TY    HDGT T GG++ +MV D+ FVVRIPE  PL+  APLLCAG+TV+SP++ + + +P                 K AK +GL
Sbjct:    5 ESEKTVTGYAARDSSGHLSPYTYNLRKKGPEDVIVKVIYCGICHSDLVQMRNEMGMSHYPMVPGHEVVGIVTEIGSEVKKFKVGEHVGVGCIVGSCRSCGNCNQSMEQYCSKRIWTYNDVNHDGTPTQGGFASSMVVDQMFVVRIPENLPLEQAAPLLCAGVTVFSPMKHFAMTEPGKKCGILGLGGVGHLGVKIAKAFGL 205          

HSP 2 Score: 48.9062 bits (115), Expect = 2.257e-65
Identity = 26/67 (38.81%), Postives = 38/67 (56.72%), Query Frame = 1
Query:  697 GADSFLVSRDQDEMQAAMGHMDGIIDTVSAVHPLMPVIGTVKSQGKXCTXG-APEKH*SYQLPLLRG 894
            GAD++LVS+D ++M  A   +D I+DT+   HPL P +  +K+ GK    G  PE       PL+ G
Sbjct:  225 GADAYLVSKDTEKMMEAAESLDYIMDTIPVAHPLEPYLALLKTNGKLVMLGVVPEPLHFVTPPLILG 291          
BLAST of EY659268 vs. ExPASy Swiss-Prot
Match: CADH2_ARATH (Cinnamyl alcohol dehydrogenase 2 OS=Arabidopsis thaliana GN=CAD2 PE=1 SV=1)

HSP 1 Score: 249.21 bits (635), Expect = 2.360e-65
Identity = 112/169 (66.27%), Postives = 134/169 (79.29%), Query Frame = 3
Query:   54 AFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTI-TYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSPLRFYGL 557
            AFGWAA D SGVLSPFHFSRR  GE DVT K+  CG+CHSDLH IKN WG + YPI+PGHEIVG+ T+VG  V+KFK GD+VGVG ++GSC+SC+SC  DLENYCPKV+ TY S+  DGT    GGYSD +V D  FV+ IP+G P D+ APLLCAGITVYSP+++YG+
Sbjct:    7 AFGWAANDESGVLSPFHFSRRENGENDVTVKILFCGVCHSDLHTIKNHWGFSRYPIIPGHEIVGIATKVGKNVTKFKEGDRVGVGVIIGSCQSCESCNQDLENYCPKVVFTYNSRSSDGTSRNQGGYSDVIVVDHRFVLSIPDGLPSDSGAPLLCAGITVYSPMKYYGM 175          
BLAST of EY659268 vs. ExPASy Swiss-Prot
Match: CADH1_TOBAC (Probable cinnamyl alcohol dehydrogenase 1 OS=Nicotiana tabacum GN=CAD14 PE=1 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 1.480e-63
Identity = 101/175 (57.71%), Postives = 123/175 (70.29%), Query Frame = 3
Query:   39 EHPKNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSPLRFYGLXQ 563
            E  K   GWAARD SGVLSP+ ++ R TG +DV  KV +CG+CH+DLH +KN+ G + YP+VPGHE+VG V EVG  VSKFKVGD VGVG +VGSCR+C  C  D+E YC K I      Y DG  T GG++ +MV D+ FVV+IPEG   +  APLLCAGITVYSPL  +G  Q
Sbjct:    5 EVEKTTIGWAARDPSGVLSPYTYTLRNTGPEDVEVKVLYCGLCHTDLHQVKNDLGMSNYPLVPGHEVVGEVVEVGPDVSKFKVGDTVGVGLLVGSCRNCGPCKRDIEQYCNKKIWNCNDVYTDGKPTQGGFAKSMVVDQKFVVKIPEGMAPEQAAPLLCAGITVYSPLNHFGFKQ 179          

HSP 2 Score: 50.0618 bits (118), Expect = 1.480e-63
Identity = 27/68 (39.71%), Postives = 36/68 (52.94%), Query Frame = 1
Query:  697 GADSFLVSRDQDEMQAAMGHMDGIIDTVSAVHPLMPVIGTVKSQGKXCTXGAPEKH*SYQLPLLRGGK 900
            GAD +LVS D D+MQ A   +D IIDTV   HPL P +  +K  GK    G       +  P++  G+
Sbjct:  225 GADDYLVSSDTDKMQEASDSLDYIIDTVPVGHPLEPYLSLLKIDGKLILMGVINTPLQFISPMVMLGR 292          

HSP 3 Score: 22.7126 bits (47), Expect = 1.480e-63
Identity = 13/27 (48.15%), Postives = 18/27 (66.67%), Query Frame = 2
Query:  617 QIRKAMGVNVTVISTXP*QXSEARDVL 697
            +I KAMG +VTVIS+   +  EA + L
Sbjct:  198 KIAKAMGHHVTVISSSNKKRQEALEHL 224          
BLAST of EY659268 vs. ExPASy Swiss-Prot
Match: CADH4_ARATH (Cinnamyl alcohol dehydrogenase 4 OS=Arabidopsis thaliana GN=CAD4 PE=1 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 5.534e-63
Identity = 101/170 (59.41%), Postives = 125/170 (73.53%), Query Frame = 3
Query:   48 KNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSPLRFYGL 557
            K A GWAARD SGVLSP+ ++ R+TG  DV  KV  CGICH+D+H IKN+ G + YP+VPGHE+VG V EVGS VSKF VGD VGVG +VG C SC  C+ +LE YC K I +Y   Y DG  T GG++DTM+ ++ FVV+IPEG  ++  APLLCAG+TVYSPL  +GL
Sbjct:    9 KKALGWAARDPSGVLSPYSYTLRSTGADDVYIKVICCGICHTDIHQIKNDLGMSNYPMVPGHEVVGEVLEVGSDVSKFTVGDVVGVGVVVGCCGSCKPCSSELEQYCNKRIWSYNDVYTDGKPTQGGFADTMIVNQKFVVKIPEGMAVEQAAPLLCAGVTVYSPLSHFGL 178          

HSP 2 Score: 46.595 bits (109), Expect = 5.534e-63
Identity = 26/68 (38.24%), Postives = 34/68 (50.00%), Query Frame = 1
Query:  697 GADSFLVSRDQDEMQAAMGHMDGIIDTVSAVHPLMPVIGTVKSQGKXCTXGAPEKH*SYQLPLLRGGK 900
            GAD ++VS D  EMQ     +D IIDTV   HPL P +  +K  GK    G       +  PL+  G+
Sbjct:  226 GADDYVVSSDPAEMQRLADSLDYIIDTVPVFHPLDPYLACLKLDGKLILMGVINTPLQFVTPLVILGR 293          

HSP 3 Score: 22.7126 bits (47), Expect = 5.534e-63
Identity = 12/23 (52.17%), Postives = 16/23 (69.57%), Query Frame = 2
Query:  617 QIRKAMGVNVTVISTXP*QXSEA 685
            +I KAMG +VTVIS+   +  EA
Sbjct:  199 KIAKAMGHHVTVISSSDKKKEEA 221          
BLAST of EY659268 vs. ExPASy Swiss-Prot
Match: CADH1_OCIBA (Cinnamyl alcohol dehydrogenase 1 OS=Ocimum basilicum GN=CAD1 PE=1 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 7.208e-63
Identity = 98/175 (56.00%), Postives = 125/175 (71.43%), Query Frame = 3
Query:   39 EHPKNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSPLRFYGLXQ 563
            E  +   GWAARD SGVLSP+ ++ R TG +DV  +V  CGICH+D+H IKN+ G + YP+VPGHE+VG V EVGS+V+KF+ GD VGVGC+VGSC +C  C  D+E YC K I +Y   Y DG  T GG++  MV D+ FVV+IP+G   +  APLLCAG+TVYSPL  +GL Q
Sbjct:    5 EVERKTVGWAARDPSGVLSPYEYTLRNTGPQDVYVEVMCCGICHTDVHQIKNDLGMSNYPMVPGHEVVGEVVEVGSEVTKFRAGDVVGVGCIVGSCGNCRPCNSDIEQYCNKKIWSYNDVYPDGKPTQGGFAGAMVVDQKFVVKIPDGMAPEQAAPLLCAGVTVYSPLNHFGLKQ 179          

HSP 2 Score: 48.1358 bits (113), Expect = 7.208e-63
Identity = 26/68 (38.24%), Postives = 34/68 (50.00%), Query Frame = 1
Query:  697 GADSFLVSRDQDEMQAAMGHMDGIIDTVSAVHPLMPVIGTVKSQGKXCTXGAPEKH*SYQLPLLRGGK 900
            GAD +LVS D   MQ A   +D IIDTV   HPL P +  +K  GK    G       +  P++  G+
Sbjct:  225 GADDYLVSSDAARMQEAADSLDYIIDTVPVFHPLEPYLSLLKIDGKLILMGVVNTPLQFVSPMVMLGR 292          

HSP 3 Score: 25.0238 bits (53), Expect = 7.208e-63
Identity = 14/27 (51.85%), Postives = 19/27 (70.37%), Query Frame = 2
Query:  617 QIRKAMGVNVTVISTXP*QXSEARDVL 697
            +I KAMG +VTVIS+   + +EA D L
Sbjct:  198 KIAKAMGHHVTVISSSDKKRAEALDHL 224          
BLAST of EY659268 vs. ExPASy Swiss-Prot
Match: CADH2_TOBAC (Probable cinnamyl alcohol dehydrogenase 2 OS=Nicotiana tabacum GN=CAD19 PE=1 SV=1)

HSP 1 Score: 214.157 bits (544), Expect = 1.222e-62
Identity = 99/172 (57.56%), Postives = 126/172 (73.26%), Query Frame = 3
Query:   48 KNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSPLRFYGLXQ 563
            K+A GWAARD SG+LSP+ ++ R TG +DV  KV +CG+CHSDLH +KN+ G + YP+VPGHE+VG V EVG+ VSKFKVGD VGVG +VGSCR+C  C  ++E YC K I      Y DG  T GG++++MV D++FVV+IPEG   +  APLLCAGITVYSP   +G  Q
Sbjct:    8 KSAIGWAARDPSGLLSPYTYTLRNTGPEDVQVKVLYCGLCHSDLHQVKNDLGMSNYPLVPGHEVVGKVVEVGADVSKFKVGDTVGVGLLVGSCRNCGPCKREIEQYCNKKIWNCNDVYTDGKPTQGGFANSMVVDQNFVVKIPEGMAPEQAAPLLCAGITVYSPFNHFGFNQ 179          

HSP 2 Score: 46.2098 bits (108), Expect = 1.222e-62
Identity = 26/68 (38.24%), Postives = 35/68 (51.47%), Query Frame = 1
Query:  697 GADSFLVSRDQDEMQAAMGHMDGIIDTVSAVHPLMPVIGTVKSQGKXCTXGAPEKH*SYQLPLLRGGK 900
            GAD +LVS D D+MQ A   +D IIDTV   HPL   +  +K  GK    G       +  P++  G+
Sbjct:  225 GADDYLVSSDTDKMQEAADSLDYIIDTVPVGHPLELYLSLLKIDGKLILIGVINTPLQFISPMVMLGR 292          

HSP 3 Score: 22.7126 bits (47), Expect = 1.222e-62
Identity = 13/27 (48.15%), Postives = 18/27 (66.67%), Query Frame = 2
Query:  617 QIRKAMGVNVTVISTXP*QXSEARDVL 697
            +I KAMG +VTVIS+   +  EA + L
Sbjct:  198 KIAKAMGHHVTVISSSNKKRQEALEHL 224          
The following BLAST results are available for this feature:
BLAST of EY659268 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 105
Match NameE-valueIdentityDescription
CADH2_PICAB5.490e-6753.23Probable cinnamyl alcohol dehydrogenase 2 OS=Picea... [more]
CADH7_PICAB1.217e-6652.74Probable cinnamyl alcohol dehydrogenase 7/8 OS=Pic... [more]
CADH3_ARATH1.251e-6666.67Cinnamyl alcohol dehydrogenase 3 OS=Arabidopsis th... [more]
CADH_PINRA7.806e-6652.24Probable cinnamyl alcohol dehydrogenase OS=Pinus r... [more]
CADH_PINTA2.257e-6552.24Probable cinnamyl alcohol dehydrogenase OS=Pinus t... [more]
CADH2_ARATH2.360e-6566.27Cinnamyl alcohol dehydrogenase 2 OS=Arabidopsis th... [more]
CADH1_TOBAC1.480e-6357.71Probable cinnamyl alcohol dehydrogenase 1 OS=Nicot... [more]
CADH4_ARATH5.534e-6359.41Cinnamyl alcohol dehydrogenase 4 OS=Arabidopsis th... [more]
CADH1_OCIBA7.208e-6356.00Cinnamyl alcohol dehydrogenase 1 OS=Ocimum basilic... [more]
CADH2_TOBAC1.222e-6257.56Probable cinnamyl alcohol dehydrogenase 2 OS=Nicot... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-008-C05-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659268 ID=EY659268|Name=EY659268|organism=Citrus sinensis|type=EST|length=901bp
ATTAAATTCATTCTGAAATGGGGCAAGCACCGGAGCAAGAGCACCCTAAG
AACGCCTTTGGATGGGCTGCCAGGGACACTTCTGGCGTTCTCTCCCCCTT
TCACTTCTCCAGAAGAGCAACGGGAGAGAAGGATGTGACATTCAAAGTAA
CTCACTGTGGGATATGCCATTCAGATCTTCACTTGATCAAAAATGAATGG
GGCAATGCCATTTACCCAATCGTCCCCGGACATGAGATTGTGGGCGTAGT
GACAGAGGTCGGAAGCAAAGTGAGTAAATTCAAAGTCGGAGACAAAGTGG
GAGTAGGATGCATGGTGGGATCATGCCGCTCTTGTGATAGCTGCGCCATT
GATCTTGAGAACTACTGCCCCAAAGTTATAATGACCTATGCCAGCAAGTA
CCATGATGGAACCATCACATACGGAGGCTACTCTGACACTATGGTTGCCG
ATGAGCACTTTGTGGTCCGTATTCCTGAAGGCGCACCACTTGACGCCACT
GCCCCTCTCCTCTGTGCTGGTATCACAGTCTACAGTCCGTTGAGATTCTA
TGGACTCGNACAGCCTGGTATGCATGTGGGTGTTGTCGGCTTGGGCGGTC
TATGCCATGTCGCTGTCAAATTCGCAAAGCTATGGGGGTTAATGTGACTG
TGATCAGTACCTNCCCCTAGCAGATNAGTGAAGCCCGTGACGTNCTGGCG
CTGATTCCTTTTTGGTCAGTCGTGATCAAGATGAGATGCAGGCTGCCATG
GGGCACATGGATGGTATCATCGATACAGTATCTGCAGTTCACCCGCTAAT
GCCCGTGATTGGNACTGTGAAATCTCAAGGAAAGNNCTGTACTNCTGGTG
CACCCGAGAAGCACTAAAGCTACCAGCTTCCCCTGCTACGGGGAGGAAAA
T
back to top