EY659268

Overview
NameEY659268
Unique NameEY659268
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length901
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig8110 contig Csv1_Contig8110:113..1014. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659268 vs. ExPASy Swiss-Prot
Match: ADH_STAES (Alcohol dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=adh PE=3 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 6.963e-17
Identity = 40/138 (28.99%), Postives = 73/138 (52.90%), Query Frame = 3
Query:  144 KVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSPLRFYGL 557
            K  +CG+CH+DLH+   ++G+ +  +  GHE +G V ++   V   KVGD+V +  M  +C +C+ C    E  C  V+       + G    G  ++ ++ D ++ V++PE     A + + CAG+T Y  ++  G+
Sbjct:   30 KTEYCGVCHTDLHVKNADFGD-VTGVTLGHEGIGRVIKIADNVDSLKVGDRVSIAWMYAACGNCEYCTTGRETLCRDVL-------NAGYTVDGAMAEEVIVDANYAVKVPENLDPAAASSITCAGVTTYKAVKVSGI 159          
BLAST of EY659268 vs. ExPASy Swiss-Prot
Match: ADH2_CAEEL (Alcohol dehydrogenase 2 OS=Caenorhabditis elegans GN=sodh-2 PE=2 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 1.005e-15
Identity = 42/141 (29.79%), Postives = 73/141 (51.77%), Query Frame = 3
Query:  126 EKDVTFKVTHCGICHSDLHLIKNEWGNA-IYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSPLR 545
            E ++  K+ + GICHSDLH  + ++  A I P++ GHE  G V  +GSKV  + +GD+ G+  +  +C +C+ C    E  C  +        + G   +G + + +   +   +++     L A AP+LC G+T Y  L+
Sbjct:   34 ENELLVKIEYSGICHSDLHTWEGDFEYASICPLIGGHEGAGTVVTIGSKVKGWNIGDRAGIKLINANCLNCEYCKTGHEPLCDHI-------QNYGIDRHGTFQEYLTIRDIDAIKVSNDTNLAAAAPVLCGGVTAYKSLK 167          
BLAST of EY659268 vs. ExPASy Swiss-Prot
Match: ADHA_MYCTU (Probable alcohol dehydrogenase adhA OS=Mycobacterium tuberculosis GN=adhA PE=3 SV=3)

HSP 1 Score: 82.8037 bits (203), Expect = 2.925e-15
Identity = 49/134 (36.57%), Postives = 67/134 (50.00%), Query Frame = 3
Query:  156 CGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVS-----KFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSPL 542
            CG+C +DLH+ + +       ++PGHE+VG V EVGS V      +F  GD+VG+  +  +C  C  C    EN CP+      S+Y  G    GGY++       F   +P G      APLLCAGI  Y  L
Sbjct:   48 CGVCRTDLHVTEGDLPVHRERVIPGHEVVGEVIEVGSAVGAAAGGEFDRGDRVGIAWLRHTCGVCKYCRRGSENLCPQ------SRY-TGWDADGGYAEFTTVPAAFAHHLPSGYSDSELAPLLCAGIIGYRSL 174          
BLAST of EY659268 vs. ExPASy Swiss-Prot
Match: ADH_STAAW (Alcohol dehydrogenase OS=Staphylococcus aureus (strain MW2) GN=adh PE=3 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 6.517e-15
Identity = 41/144 (28.47%), Postives = 70/144 (48.61%), Query Frame = 3
Query:  114 RATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSPLR 545
            RA    +   +  +CG+CH+DLH+   ++G+ +  +  GHE +G V EV   V   K+GD+V +  M  SC  C+ C    E  C  V        + G    G  ++ ++    + V++PE     A + + CAG+T Y  ++
Sbjct:   20 RALKPGEALVQTEYCGVCHTDLHVKNADFGD-VTGVTLGHEGIGKVIEVAEDVESLKIGDRVSIAWMFESCGRCEYCTTGRETLCRSV-------KNAGYTVDGAMAEQVIVTADYAVKVPEKLDPAAASSITCAGVTTYKAVK 155          
BLAST of EY659268 vs. ExPASy Swiss-Prot
Match: ADH_STAAS (Alcohol dehydrogenase OS=Staphylococcus aureus (strain MSSA476) GN=adh PE=3 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 6.517e-15
Identity = 41/144 (28.47%), Postives = 70/144 (48.61%), Query Frame = 3
Query:  114 RATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSPLR 545
            RA    +   +  +CG+CH+DLH+   ++G+ +  +  GHE +G V EV   V   K+GD+V +  M  SC  C+ C    E  C  V        + G    G  ++ ++    + V++PE     A + + CAG+T Y  ++
Sbjct:   20 RALKPGEALVQTEYCGVCHTDLHVKNADFGD-VTGVTLGHEGIGKVIEVAEDVESLKIGDRVSIAWMFESCGRCEYCTTGRETLCRSV-------KNAGYTVDGAMAEQVIVTADYAVKVPEKLDPAAASSITCAGVTTYKAVK 155          
BLAST of EY659268 vs. ExPASy Swiss-Prot
Match: ADH_STAAR (Alcohol dehydrogenase OS=Staphylococcus aureus (strain MRSA252) GN=adh PE=3 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 6.517e-15
Identity = 41/144 (28.47%), Postives = 70/144 (48.61%), Query Frame = 3
Query:  114 RATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSPLR 545
            RA    +   +  +CG+CH+DLH+   ++G+ +  +  GHE +G V EV   V   K+GD+V +  M  SC  C+ C    E  C  V        + G    G  ++ ++    + V++PE     A + + CAG+T Y  ++
Sbjct:   20 RALKPGEALVQTEYCGVCHTDLHVKNADFGD-VTGVTLGHEGIGKVIEVAEDVESLKIGDRVSIAWMFESCGRCEYCTTGRETLCRSV-------KNAGYTVDGAMAEQVIVTADYAVKVPEKLDPAAASSITCAGVTTYKAVK 155          
BLAST of EY659268 vs. ExPASy Swiss-Prot
Match: ADH_STAAN (Alcohol dehydrogenase OS=Staphylococcus aureus (strain N315) GN=adh PE=1 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 6.517e-15
Identity = 41/144 (28.47%), Postives = 70/144 (48.61%), Query Frame = 3
Query:  114 RATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSPLR 545
            RA    +   +  +CG+CH+DLH+   ++G+ +  +  GHE +G V EV   V   K+GD+V +  M  SC  C+ C    E  C  V        + G    G  ++ ++    + V++PE     A + + CAG+T Y  ++
Sbjct:   20 RALKPGEALVQTEYCGVCHTDLHVKNADFGD-VTGVTLGHEGIGKVIEVAEDVESLKIGDRVSIAWMFESCGRCEYCTTGRETLCRSV-------KNAGYTVDGAMAEQVIVTADYAVKVPEKLDPAAASSITCAGVTTYKAVK 155          
BLAST of EY659268 vs. ExPASy Swiss-Prot
Match: ADH_STAAM (Alcohol dehydrogenase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=adh PE=3 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 6.517e-15
Identity = 41/144 (28.47%), Postives = 70/144 (48.61%), Query Frame = 3
Query:  114 RATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSPLR 545
            RA    +   +  +CG+CH+DLH+   ++G+ +  +  GHE +G V EV   V   K+GD+V +  M  SC  C+ C    E  C  V        + G    G  ++ ++    + V++PE     A + + CAG+T Y  ++
Sbjct:   20 RALKPGEALVQTEYCGVCHTDLHVKNADFGD-VTGVTLGHEGIGKVIEVAEDVESLKIGDRVSIAWMFESCGRCEYCTTGRETLCRSV-------KNAGYTVDGAMAEQVIVTADYAVKVPEKLDPAAASSITCAGVTTYKAVK 155          
BLAST of EY659268 vs. ExPASy Swiss-Prot
Match: ADH_STAAC (Alcohol dehydrogenase OS=Staphylococcus aureus (strain COL) GN=adh PE=3 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 6.517e-15
Identity = 41/144 (28.47%), Postives = 70/144 (48.61%), Query Frame = 3
Query:  114 RATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSPLR 545
            RA    +   +  +CG+CH+DLH+   ++G+ +  +  GHE +G V EV   V   K+GD+V +  M  SC  C+ C    E  C  V        + G    G  ++ ++    + V++PE     A + + CAG+T Y  ++
Sbjct:   20 RALKPGEALVQTEYCGVCHTDLHVKNADFGD-VTGVTLGHEGIGKVIEVAEDVESLKIGDRVSIAWMFESCGRCEYCTTGRETLCRSV-------KNAGYTVDGAMAEQVIVTADYAVKVPEKLDPAAASSITCAGVTTYKAVK 155          
BLAST of EY659268 vs. ExPASy Swiss-Prot
Match: ADH_STAAB (Alcohol dehydrogenase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=adh PE=3 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 6.517e-15
Identity = 41/144 (28.47%), Postives = 70/144 (48.61%), Query Frame = 3
Query:  114 RATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSPLR 545
            RA    +   +  +CG+CH+DLH+   ++G+ +  +  GHE +G V EV   V   K+GD+V +  M  SC  C+ C    E  C  V        + G    G  ++ ++    + V++PE     A + + CAG+T Y  ++
Sbjct:   20 RALKPGEALVQTEYCGVCHTDLHVKNADFGD-VTGVTLGHEGIGKVIEVAEDVESLKIGDRVSIAWMFESCGRCEYCTTGRETLCRSV-------KNAGYTVDGAMAEQVIVTADYAVKVPEKLDPAAASSITCAGVTTYKAVK 155          
The following BLAST results are available for this feature:
BLAST of EY659268 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 105
Match NameE-valueIdentityDescription
ADH_STAES6.963e-1728.99Alcohol dehydrogenase OS=Staphylococcus epidermidi... [more]
ADH2_CAEEL1.005e-1529.79Alcohol dehydrogenase 2 OS=Caenorhabditis elegans ... [more]
ADHA_MYCTU2.925e-1536.57Probable alcohol dehydrogenase adhA OS=Mycobacteri... [more]
ADH_STAAW6.517e-1528.47Alcohol dehydrogenase OS=Staphylococcus aureus (st... [more]
ADH_STAAS6.517e-1528.47Alcohol dehydrogenase OS=Staphylococcus aureus (st... [more]
ADH_STAAR6.517e-1528.47Alcohol dehydrogenase OS=Staphylococcus aureus (st... [more]
ADH_STAAN6.517e-1528.47Alcohol dehydrogenase OS=Staphylococcus aureus (st... [more]
ADH_STAAM6.517e-1528.47Alcohol dehydrogenase OS=Staphylococcus aureus (st... [more]
ADH_STAAC6.517e-1528.47Alcohol dehydrogenase OS=Staphylococcus aureus (st... [more]
ADH_STAAB6.517e-1528.47Alcohol dehydrogenase OS=Staphylococcus aureus (st... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-008-C05-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659268 ID=EY659268|Name=EY659268|organism=Citrus sinensis|type=EST|length=901bp
ATTAAATTCATTCTGAAATGGGGCAAGCACCGGAGCAAGAGCACCCTAAG
AACGCCTTTGGATGGGCTGCCAGGGACACTTCTGGCGTTCTCTCCCCCTT
TCACTTCTCCAGAAGAGCAACGGGAGAGAAGGATGTGACATTCAAAGTAA
CTCACTGTGGGATATGCCATTCAGATCTTCACTTGATCAAAAATGAATGG
GGCAATGCCATTTACCCAATCGTCCCCGGACATGAGATTGTGGGCGTAGT
GACAGAGGTCGGAAGCAAAGTGAGTAAATTCAAAGTCGGAGACAAAGTGG
GAGTAGGATGCATGGTGGGATCATGCCGCTCTTGTGATAGCTGCGCCATT
GATCTTGAGAACTACTGCCCCAAAGTTATAATGACCTATGCCAGCAAGTA
CCATGATGGAACCATCACATACGGAGGCTACTCTGACACTATGGTTGCCG
ATGAGCACTTTGTGGTCCGTATTCCTGAAGGCGCACCACTTGACGCCACT
GCCCCTCTCCTCTGTGCTGGTATCACAGTCTACAGTCCGTTGAGATTCTA
TGGACTCGNACAGCCTGGTATGCATGTGGGTGTTGTCGGCTTGGGCGGTC
TATGCCATGTCGCTGTCAAATTCGCAAAGCTATGGGGGTTAATGTGACTG
TGATCAGTACCTNCCCCTAGCAGATNAGTGAAGCCCGTGACGTNCTGGCG
CTGATTCCTTTTTGGTCAGTCGTGATCAAGATGAGATGCAGGCTGCCATG
GGGCACATGGATGGTATCATCGATACAGTATCTGCAGTTCACCCGCTAAT
GCCCGTGATTGGNACTGTGAAATCTCAAGGAAAGNNCTGTACTNCTGGTG
CACCCGAGAAGCACTAAAGCTACCAGCTTCCCCTGCTACGGGGAGGAAAA
T
back to top