EY659267

Overview
NameEY659267
Unique NameEY659267
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length934
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
EY659267_ssr187 microsatellite EY659267_ssr187:187..198. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of EY659267 vs. ExPASy Swiss-Prot
Match: SC11C_CANFA (Signal peptidase complex catalytic subunit SEC11C OS=Canis familiaris GN=SEC11C PE=1 SV=3)

HSP 1 Score: 120.168 bits (300), Expect = 1.745e-26
Identity = 60/93 (64.52%), Postives = 77/93 (82.80%), Query Frame = 2
Query:   71 IKSLQIRQVLTQGVSLGMIVTSALIIWKALMCITGSESPVVVVLSGSMEPGFKRGDILFL-HMSKDPIRAGEIVVFNVDGREIPIVHRVIKVN 346
            ++ +  RQ+  Q ++  MIV+SAL+IWK L+ +TGSESP+VVVLSGSMEP F RGD+LFL +  +DPIRAGEIVVF V+GR+IPIVHRVIKV+
Sbjct:   22 LRKMNKRQLYYQVLNFAMIVSSALMIWKGLIVLTGSESPIVVVLSGSMEPAFHRGDLLFLTNFREDPIRAGEIVVFKVEGRDIPIVHRVIKVH 114          
BLAST of EY659267 vs. ExPASy Swiss-Prot
Match: SEC11_DICDI (Signal peptidase complex catalytic subunit sec11 OS=Dictyostelium discoideum GN=sec11 PE=3 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 1.383e-23
Identity = 51/90 (56.67%), Postives = 70/90 (77.78%), Query Frame = 2
Query:   77 SLQIRQVLTQGVSLGMIVTSALIIWKALMCITGSESPVVVVLSGSMEPGFKRGDILFLHMSKDPIRAGEIVVFNVDGREIPIVHRVIKVN 346
            S+   Q+  Q V+ G+IV +AL+IWK LM  +GSESP+VVVLSGSM P F RGD+L+L+M   P R GEIVVF ++G+EIPIVHR+++++
Sbjct:   13 SIPKHQIAQQIVNFGLIVATALMIWKGLMIFSGSESPIVVVLSGSMIPAFFRGDLLYLNMEDGPFRVGEIVVFKIEGKEIPIVHRILQIH 102          
BLAST of EY659267 vs. ExPASy Swiss-Prot
Match: SC11B_HUMAN (Putative signal peptidase complex catalytic subunit SEC11B OS=Homo sapiens GN=SEC11B PE=5 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 6.424e-21
Identity = 52/82 (63.41%), Postives = 67/82 (81.71%), Query Frame = 2
Query:  104 QGVSLGMIVTSALIIWKALMCITGSESPVVVVLSGSMEPGFKRGDILFL-HMSKDPIRAGEIVVFNVDGREIPIVHRVIKVN 346
            Q ++ GMIV+SAL+IWK LM ITGSESP +V+LSGSMEP F RG +LFL +  +DPIR GEI V  ++GR+IPIVHRV+K++
Sbjct:    9 QVLNFGMIVSSALMIWKGLMVITGSESP-IVLLSGSMEPAFHRGYLLFLTNRVEDPIRVGEIAVLRIEGRKIPIVHRVLKIH 89          
BLAST of EY659267 vs. ExPASy Swiss-Prot
Match: SEC11_YEAST (Signal peptidase complex catalytic subunit SEC11 OS=Saccharomyces cerevisiae GN=SEC11 PE=1 SV=2)

HSP 1 Score: 82.8037 bits (203), Expect = 3.088e-15
Identity = 40/87 (45.98%), Postives = 60/87 (68.97%), Query Frame = 2
Query:   80 LQIRQVLTQGVSLGMIVTSALIIWKALMCITGSESPVVVVLSGSMEPGFKRGDILFLHMSKDPIRAGEIVVFNVDGREIPIVHRVIK 340
            + +R  L + +++  +  SA + W+ L   T S SP+VVVLSGSMEP F+RGDILFL       + G++VV+ V+G++IPIVHRV++
Sbjct:    1 MNLRFELQKLLNVCFLFASAYMFWQGLAIATNSASPIVVVLSGSMEPAFQRGDILFLWNRNTFNQVGDVVVYEVEGKQIPIVHRVLR 87          
BLAST of EY659267 vs. ExPASy Swiss-Prot
Match: SEC11_SCHPO (Signal peptidase complex catalytic subunit sec11 OS=Schizosaccharomyces pombe GN=sec11 PE=2 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 9.934e-14
Identity = 45/109 (41.28%), Postives = 66/109 (60.55%), Query Frame = 2
Query:   71 IKSLQIRQVLTQGVSLGMIVTSALIIWKALMCITGSESPVVVVLSGSMEPGFKRGDILFLH------------------MSKDPIRAGEIVVFNVDGREIPIVHRVIKV 343
            ++ L  RQ L Q ++L ++++SA + +K L  +T  ESPVVVVLS SMEP F+RGD+LFL                   +   P+  G+IVV+++  R IPIVHRV+K+
Sbjct:    1 MQKLSFRQGLAQILNLLLVLSSAYMGYKTLSFVTDCESPVVVVLSESMEPSFQRGDLLFLDNRNPSFDEAKVPSVFEKIIYGSPVGIGDIVVYSLPDRPIPIVHRVVKL 109          
The following BLAST results are available for this feature:
BLAST of EY659267 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 15
Match NameE-valueIdentityDescription
SC11C_CANFA1.745e-2664.52Signal peptidase complex catalytic subunit SEC11C ... [more]
SEC11_DICDI1.383e-2356.67Signal peptidase complex catalytic subunit sec11 O... [more]
SC11B_HUMAN6.424e-2163.41Putative signal peptidase complex catalytic subuni... [more]
SEC11_YEAST3.088e-1545.98Signal peptidase complex catalytic subunit SEC11 O... [more]
SEC11_SCHPO9.934e-1441.28Signal peptidase complex catalytic subunit sec11 O... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-008-C04-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659267 ID=EY659267|Name=EY659267|organism=Citrus sinensis|type=EST|length=934bp
CCACGCGTCCGCATAAACATAAACAGAGAAGATAAAAAGAATGGGGTGGA
TCGGGGAAAGCATATAGTCGATCAAGTCCCTTCAGATCCGCCAGGTCCTT
ACTCAGGGCGTCAGTCTTGGTATGATTGTTACATCTGCTTTAATAATATG
GAAGGCATTGATGTGCATCACTGGCAGTGAATCTCCTGTTGTTGTTGTTC
TTTCTGGAAGCATGGAACCTGGCTTCAAGAGGGGAGATATTTTGTTCTTG
CATATGAGTAAAGATCCTATTCGTGCTGGAGAGATTGTTGTTTTTAATGT
TGATGGCCGGGAAATTCCAATTGTCCATCGAGTTATTAAGGTGAATATTT
TATTGACCTTATTCTTTGAATTGACGATACAACCTTGCTGCCTATAATGT
GCTTATCTGTGCTGGTAAATACTTGCTTTTTGATTATATGCGCTTACCAT
GTGCTTGACCACCTTCTTAATTTGTGATATTTTCCTAAAGATTGCTATGT
TAGGACTAGGTGATAGATACATTGAGCCTTTTACTTTCATGATTCTTTTA
GTTTTTTGAGGATCCTTTGTCTTCTTGAAACTTTCTGTACTTTATATGTA
CTAGAGCTCATTTTCTTGTACTAACCAAGGTTCGTCTGTCTAACCACAAG
TAGAAAGGCCCTCTTGTTTTTTTCTCGGGTGCCTTTTGCCTGAAACAGTG
TCTANCCATCCTAATATTAAATTGGATGGCGGCTCACGAACGGCAAGATA
CTGGGGAAGTTGGAGGCCTAACAAAGGGAATACCATTATGGGGATAAAGG
TTTTGTTTGCTAAAGGCAGCTTTGGCTTAGCGACAACTTTATGGGCAGAC
TGGGGGGAAAAACCTTATCCAACCTTTGGTCTCCGGATTTTTCATCTATA
CGAGACATTATCATTTGATGACCAGGAGGAGTGA
back to top