EY659233

Overview
NameEY659233
Unique NameEY659233
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length817
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBE2C_BOVIN (Ubiquitin-conjugating enzyme E2 C OS=Bos taurus GN=UBE2C PE=2 SV=1)

HSP 1 Score: 57.7658 bits (138), Expect = 1.567e-11
Identity = 21/45 (46.67%), Postives = 33/45 (73.33%), Query Frame = 2
Query:  344 FLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWS 478
            + +++ FP  YP+  P V F T  +HPN+++ G+ICLDILK++WS
Sbjct:   79 YKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKDKWS 123          

HSP 2 Score: 32.7278 bits (73), Expect = 1.567e-11
Identity = 15/46 (32.61%), Postives = 25/46 (54.35%), Query Frame = 3
Query:  201 KRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYADMQ 338
            KR+ +EL  L        SA P ++++F W  TI G + + Y D++
Sbjct:   33 KRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLR 78          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: U2D2L_HUMAN (Putative ubiquitin-conjugating enzyme E2 D2-like protein OS=Homo sapiens GN=UBE2DNL PE=5 SV=1)

HSP 1 Score: 56.225 bits (134), Expect = 2.170e-11
Identity = 26/45 (57.78%), Postives = 30/45 (66.67%), Query Frame = 3
Query:  192 MASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPY 326
            MA K I KE  +L +DP   CSAGP  +DM HWQATI  P+DS Y
Sbjct:    1 MALKLIHKEFLELARDPQPHCSAGPVWDDMLHWQATITRPNDSSY 45          

HSP 2 Score: 33.8834 bits (76), Expect = 2.170e-11
Identity = 14/28 (50.00%), Postives = 18/28 (64.29%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFH 421
            GVF   + FP DY FKPPK+ F   ++H
Sbjct:   48 GVFF--LKFPSDYLFKPPKIKFTNGIYH 73          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBE2T_MOUSE (Ubiquitin-conjugating enzyme E2 T OS=Mus musculus GN=Ube2t PE=2 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 2.623e-11
Identity = 29/60 (48.33%), Postives = 41/60 (68.33%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDIL----KEQWSPALTISKMV 505
            GVF + +  P  YPF+PP+V F T ++HPNI+S+G ICLDIL    K  W P+L I+ ++
Sbjct:   49 GVFTLEVIIPERYPFEPPQVRFLTPIYHPNIDSSGRICLDILKLPPKGAWRPSLNIATVL 108          

HSP 2 Score: 25.7942 bits (55), Expect = 2.623e-11
Identity = 12/43 (27.91%), Postives = 23/43 (53.49%), Query Frame = 3
Query:  198 SKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPY 326
            + R+ KEL  L  +PP   +     + +   +A I+G +++PY
Sbjct:    4 ASRLKKELHMLAIEPPPGITCWQEKDQVADLRAQILGGANTPY 46          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBE2C_MOUSE (Ubiquitin-conjugating enzyme E2 C OS=Mus musculus GN=Ube2c PE=2 SV=1)

HSP 1 Score: 57.7658 bits (138), Expect = 2.642e-11
Identity = 21/45 (46.67%), Postives = 33/45 (73.33%), Query Frame = 2
Query:  344 FLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWS 478
            + +++ FP  YP+  P V F T  +HPN+++ G+ICLDILK++WS
Sbjct:   79 YKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKDKWS 123          

HSP 2 Score: 31.9574 bits (71), Expect = 2.642e-11
Identity = 15/46 (32.61%), Postives = 25/46 (54.35%), Query Frame = 3
Query:  201 KRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYADMQ 338
            KR+ +EL  L        SA P ++++F W  TI G + + Y D++
Sbjct:   33 KRLQQELMILMTSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLR 78          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC37_ARATH (Probable ubiquitin carrier protein E2 37 OS=Arabidopsis thaliana GN=UBC37 PE=2 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 3.314e-11
Identity = 29/60 (48.33%), Postives = 41/60 (68.33%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDIL----KEQWSPALTISKMV 505
            G+F + I  P  YPF+PP V+F T ++HPNI+++G ICLDIL    K  W P+L IS ++
Sbjct:   62 GIFNLKIQIPERYPFQPPIVSFATPIYHPNIDNSGRICLDILNLPPKGAWQPSLNISTVL 121          

HSP 2 Score: 25.0238 bits (53), Expect = 3.314e-11
Identity = 20/54 (37.04%), Postives = 25/54 (46.30%), Query Frame = 3
Query:  198 SKRILKELKDLQKDPPTSC------SAGPAAEDMFHW---QATIMGPSDSPYAD 332
            S R+ KELK L  DPP         SA   + D   +    A I GP D+ YA+
Sbjct:    8 SLRMQKELKLLLSDPPHGASFPHLSSAANGSGDFSTFSTIDAQIEGPEDTVYAN 61          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBE2T_BOVIN (Ubiquitin-conjugating enzyme E2 T OS=Bos taurus GN=UBE2T PE=2 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 3.413e-11
Identity = 27/60 (45.00%), Postives = 41/60 (68.33%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDIL----KEQWSPALTISKMV 505
            GVF + ++ P  YPF+PP++ F T ++HPNI+S G ICLD+L    K  W P+L I+ ++
Sbjct:   49 GVFKLEVHIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATLL 108          

HSP 2 Score: 25.7942 bits (55), Expect = 3.413e-11
Identity = 12/43 (27.91%), Postives = 23/43 (53.49%), Query Frame = 3
Query:  198 SKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPY 326
            + R+ +EL  L  +PP   +     + M   +A I+G +++PY
Sbjct:    4 TSRLKRELSLLAAEPPPGITCWQDGDRMEDLRAQILGGANTPY 46          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC84_DROME (Ubiquitin-conjugating enzyme E2-18 kDa OS=Drosophila melanogaster GN=Ubc84D PE=1 SV=2)

HSP 1 Score: 68.9366 bits (167), Expect = 3.766e-11
Identity = 25/58 (43.10%), Postives = 39/58 (67.24%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILK-EQWSPALTISKMVK 508
            G F + INFPP YPF PPK+ F+TK++HPN++  G +CL I+  + W P     ++++
Sbjct:   49 GAFRIEINFPPQYPFMPPKILFKTKIYHPNVDEKGEVCLPIISTDNWKPTTRTEQVLQ 106          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBE2S_DICDI (Ubiquitin-conjugating enzyme E2 S OS=Dictyostelium discoideum GN=ube2s PE=3 SV=1)

HSP 1 Score: 53.9138 bits (128), Expect = 4.408e-11
Identity = 26/75 (34.67%), Postives = 40/75 (53.33%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTIS------KMVKL*TNARYSADDD 544
            G F   +    D+P  PPK  F TK+FHPN++  G IC++ LK+ W+  L +       K + +  NA  S ++D
Sbjct:   56 GYFKARLILSSDFPRSPPKANFITKIFHPNVSKKGEICVNTLKKDWTEDLGLKHILLTIKCLLIVPNAESSLNED 130          

HSP 2 Score: 35.039 bits (79), Expect = 4.408e-11
Identity = 15/42 (35.71%), Postives = 25/42 (59.52%), Query Frame = 3
Query:  201 KRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPY 326
            KR++KELK+L        +  P  ED+ + +A + GP+ +PY
Sbjct:   12 KRVVKELKELNSSTLEGITLLPCEEDITNIEAVVTGPAGTPY 53          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBE2T_HUMAN (Ubiquitin-conjugating enzyme E2 T OS=Homo sapiens GN=UBE2T PE=1 SV=1)

HSP 1 Score: 61.6178 bits (148), Expect = 9.688e-11
Identity = 27/60 (45.00%), Postives = 40/60 (66.67%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDIL----KEQWSPALTISKMV 505
            GVF + +  P  YPF+PP++ F T ++HPNI+S G ICLD+L    K  W P+L I+ ++
Sbjct:   49 GVFKLEVIIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVL 108          

HSP 2 Score: 26.1794 bits (56), Expect = 9.688e-11
Identity = 12/43 (27.91%), Postives = 23/43 (53.49%), Query Frame = 3
Query:  198 SKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPY 326
            + R+ +EL  L  +PP   +     + M   +A I+G +++PY
Sbjct:    4 ASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPY 46          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC7_ARATH (Ubiquitin-conjugating enzyme E2 7 OS=Arabidopsis thaliana GN=UBC7 PE=2 SV=1)

HSP 1 Score: 49.6766 bits (117), Expect = 9.803e-11
Identity = 22/69 (31.88%), Postives = 36/69 (52.17%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDIL-------------KEQWSPALTISKMV 505
            G F   + FP +YP  PP V F + ++HPN+ S+G +C+ IL              E+W+P  T+  ++
Sbjct:   52 GFFNAIMTFPQNYPNSPPTVRFTSDMWHPNVYSDGRVCISILHPPGDDPSGYELASERWTPVHTVESIM 120          

HSP 2 Score: 38.1206 bits (87), Expect = 9.803e-11
Identity = 21/45 (46.67%), Postives = 27/45 (60.00%), Query Frame = 3
Query:  195 ASKRILKELKDLQKDPPTSCSAGPAAE-DMFHWQATIMGPSDSPY 326
            AS  + K+LKDL K P    SAG   E ++F W  TI+GP D+ Y
Sbjct:    5 ASLLLQKQLKDLCKHPVDGFSAGLVDEKNIFEWSVTIIGPPDTLY 49          
The following BLAST results are available for this feature:
BLAST of EY659233 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 160
Match NameE-valueIdentityDescription
UBE2C_BOVIN1.567e-1146.67Ubiquitin-conjugating enzyme E2 C OS=Bos taurus GN... [more]
U2D2L_HUMAN2.170e-1157.78Putative ubiquitin-conjugating enzyme E2 D2-like p... [more]
UBE2T_MOUSE2.623e-1148.33Ubiquitin-conjugating enzyme E2 T OS=Mus musculus ... [more]
UBE2C_MOUSE2.642e-1146.67Ubiquitin-conjugating enzyme E2 C OS=Mus musculus ... [more]
UBC37_ARATH3.314e-1148.33Probable ubiquitin carrier protein E2 37 OS=Arabid... [more]
UBE2T_BOVIN3.413e-1145.00Ubiquitin-conjugating enzyme E2 T OS=Bos taurus GN... [more]
UBC84_DROME3.766e-1143.10Ubiquitin-conjugating enzyme E2-18 kDa OS=Drosophi... [more]
UBE2S_DICDI4.408e-1134.67Ubiquitin-conjugating enzyme E2 S OS=Dictyostelium... [more]
UBE2T_HUMAN9.688e-1145.00Ubiquitin-conjugating enzyme E2 T OS=Homo sapiens ... [more]
UBC7_ARATH9.803e-1131.88Ubiquitin-conjugating enzyme E2 7 OS=Arabidopsis t... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-H03-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659233 ID=EY659233|Name=EY659233|organism=Citrus sinensis|type=EST|length=817bp
TCTTTCTCGACGATATTTGTGTTGAAGAACAAAACAGGGGTTGTTAGAGG
AGCGAGGCGGGGGCGGCTTGACGACGTAGATCTGCTTCACCGTTTCGCTT
TCTCGACGCTATTACCCTACGATCCTGTTCTCTGCCGCGCAAGGTCTTAA
GGTTCGTTGTAGCTTTAATTTTAATAACCCCTTGAAGAGTCATGGCTTCA
AAGCGTATTTTGAAGGAACTCAAGGATCTGCAAAAGGATCCTCCCACATC
TTGCAGCGCTGGCCCTGCGGCTGAAGACATGTTCCACTGGCAAGCCACAA
TTATGGGCCCTTCTGATAGCCCATATGCTGATATGCAGGTGTATTTTTAG
TTGCCATTAATTTTCCTCCTGATTATCCTTTCAAGCCCCCAAAGGTTGCT
TTTAGGACCAAGGTCTTCCACCCGAACATCAACAGCAATGGAAGCATCTG
TCTTGATATCCTTAAAGAACAGTGGAGTCCTGCGCTTACCATTTCAAAGA
TGGTGAAGTTGTAAACGAATGCGCGATATAGTGCGGACGATGATTGGTTG
TTGAATACATTTCATGTGATATTGGCCATTCTCAGAACCTAACTCACTCT
GTAAATGCTTGAGCCTTTTGACTAAAGATTATTCAATGTATTGCCGCTGG
AAGATGGTATTGCTNCTGGNAAGTCTGCTGNTGGAATATTTNCATTTTAT
CTTGGNAAGTNNNTGTGGAGAGCTTGGCTCGGTGGCCGGAATTTNNGATA
CTNNTATGGNNAGTTAATGGGAATTTAACTATNGTTTTATATTTGGCATT
CCTTTTTTTTTTATTTA
back to top