EY659233

Overview
NameEY659233
Unique NameEY659233
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length817
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBE2B_HUMAN (Ubiquitin-conjugating enzyme E2 B OS=Homo sapiens GN=UBE2B PE=1 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 6.320e-19
Identity = 28/56 (50.00%), Postives = 40/56 (71.43%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            G F + I F  +YP KPP V F +K+FHPN+ ++GSICLDIL+ +WSP   +S ++
Sbjct:   51 GTFKLVIEFSEEYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSIL 106          

HSP 2 Score: 46.9802 bits (110), Expect = 6.320e-19
Identity = 17/46 (36.96%), Postives = 28/46 (60.87%), Query Frame = 3
Query:  195 ASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYAD 332
            A +R++++ K LQ+DPP   S  P+  ++  W A I GP  +P+ D
Sbjct:    5 ARRRLMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFED 50          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBE2B_BOVIN (Ubiquitin-conjugating enzyme E2 B OS=Bos taurus GN=UBE2B PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 6.320e-19
Identity = 28/56 (50.00%), Postives = 40/56 (71.43%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            G F + I F  +YP KPP V F +K+FHPN+ ++GSICLDIL+ +WSP   +S ++
Sbjct:   51 GTFKLVIEFSEEYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSIL 106          

HSP 2 Score: 46.9802 bits (110), Expect = 6.320e-19
Identity = 17/46 (36.96%), Postives = 28/46 (60.87%), Query Frame = 3
Query:  195 ASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYAD 332
            A +R++++ K LQ+DPP   S  P+  ++  W A I GP  +P+ D
Sbjct:    5 ARRRLMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFED 50          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBE2C_DICDI (Probable ubiquitin-conjugating enzyme E2 C OS=Dictyostelium discoideum GN=ube2c PE=3 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 8.219e-19
Identity = 28/54 (51.85%), Postives = 42/54 (77.78%), Query Frame = 2
Query:  344 FLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            F +++ FP DYP+KPP V F T+ FHPN+++NG+ICLDILK++WSP   +  ++
Sbjct:   55 FKMSLKFPTDYPYKPPTVKFETQCFHPNVDNNGNICLDILKDKWSPVYNVRSLL 108          

HSP 2 Score: 39.2762 bits (90), Expect = 8.219e-19
Identity = 18/47 (38.30%), Postives = 26/47 (55.32%), Query Frame = 3
Query:  198 SKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYADMQ 338
            SKR+  EL +L   P    SA P  +++F+W  TI G  D+ Y  M+
Sbjct:    8 SKRLQSELMNLMMGPSPGISAFPDGDNIFNWIGTIQGAKDTVYEQME 54          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC2_ARATH (Ubiquitin-conjugating enzyme E2 2 OS=Arabidopsis thaliana GN=UBC2 PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 1.390e-18
Identity = 28/56 (50.00%), Postives = 41/56 (73.21%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            G F +++ F  DYP KPP V F +++FHPNI ++GSICLDIL+ QWSP   ++ ++
Sbjct:   51 GTFKLSLQFSEDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAIL 106          

HSP 2 Score: 46.2098 bits (108), Expect = 1.390e-18
Identity = 18/44 (40.91%), Postives = 27/44 (61.36%), Query Frame = 3
Query:  195 ASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPY 326
            A KR++++ K LQ+DPP   S  P   ++  W A I GP D+P+
Sbjct:    5 ARKRLMRDFKRLQQDPPAGISGAPQDNNIMLWNAVIFGPDDTPW 48          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC1_ARATH (Ubiquitin-conjugating enzyme E2 1 OS=Arabidopsis thaliana GN=UBC1 PE=1 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 1.390e-18
Identity = 28/56 (50.00%), Postives = 41/56 (73.21%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            G F +++ F  DYP KPP V F +++FHPNI ++GSICLDIL+ QWSP   ++ ++
Sbjct:   51 GTFKLSLQFSEDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAIL 106          

HSP 2 Score: 46.2098 bits (108), Expect = 1.390e-18
Identity = 18/44 (40.91%), Postives = 27/44 (61.36%), Query Frame = 3
Query:  195 ASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPY 326
            A KR++++ K LQ+DPP   S  P   ++  W A I GP D+P+
Sbjct:    5 ARKRLMRDFKRLQQDPPAGISGAPQDNNIMLWNAVIFGPDDTPW 48          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBE2A_MOUSE (Ubiquitin-conjugating enzyme E2 A OS=Mus musculus GN=Ube2a PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 1.808e-18
Identity = 28/56 (50.00%), Postives = 40/56 (71.43%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            G F + I F  +YP KPP V F +K+FHPN+ ++GSICLDIL+ +WSP   +S ++
Sbjct:   51 GTFKLTIEFTEEYPNKPPTVRFVSKMFHPNVYADGSICLDILQNRWSPTYDVSSIL 106          

HSP 2 Score: 45.8246 bits (107), Expect = 1.808e-18
Identity = 17/46 (36.96%), Postives = 28/46 (60.87%), Query Frame = 3
Query:  195 ASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYAD 332
            A +R++++ K LQ+DPP   S  P+  ++  W A I GP  +P+ D
Sbjct:    5 ARRRLMRDFKRLQEDPPAGVSGAPSENNIMVWNAVIFGPEGTPFED 50          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBE2A_HUMAN (Ubiquitin-conjugating enzyme E2 A OS=Homo sapiens GN=UBE2A PE=2 SV=2)

HSP 1 Score: 68.1662 bits (165), Expect = 1.808e-18
Identity = 28/56 (50.00%), Postives = 40/56 (71.43%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            G F + I F  +YP KPP V F +K+FHPN+ ++GSICLDIL+ +WSP   +S ++
Sbjct:   51 GTFKLTIEFTEEYPNKPPTVRFVSKMFHPNVYADGSICLDILQNRWSPTYDVSSIL 106          

HSP 2 Score: 45.8246 bits (107), Expect = 1.808e-18
Identity = 17/46 (36.96%), Postives = 28/46 (60.87%), Query Frame = 3
Query:  195 ASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYAD 332
            A +R++++ K LQ+DPP   S  P+  ++  W A I GP  +P+ D
Sbjct:    5 ARRRLMRDFKRLQEDPPAGVSGAPSENNIMVWNAVIFGPEGTPFED 50          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC1_CAEEL (Ubiquitin-conjugating enzyme E2 1 OS=Caenorhabditis elegans GN=ubc-1 PE=1 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 2.324e-18
Identity = 26/56 (46.43%), Postives = 41/56 (73.21%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            G F +++ F  +YP KPP V F +K+FHPN+ ++GSICLDIL+ +WSP   ++ ++
Sbjct:   51 GTFKLSLEFTEEYPNKPPTVKFISKMFHPNVYADGSICLDILQNRWSPTYDVAAIL 106          

HSP 2 Score: 47.3654 bits (111), Expect = 2.324e-18
Identity = 16/44 (36.36%), Postives = 29/44 (65.91%), Query Frame = 3
Query:  201 KRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYAD 332
            +R++++ K LQ+DPP   S  P  +++  W+A I GP ++P+ D
Sbjct:    7 RRLMRDFKKLQEDPPAGVSGAPTEDNILTWEAIIFGPQETPFED 50          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC2_USTMA (Ubiquitin-conjugating enzyme E2 2 OS=Ustilago maydis GN=UBC2 PE=3 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 2.327e-18
Identity = 25/56 (44.64%), Postives = 38/56 (67.86%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            G F + + F   YP KPP V F +K+FHPN+ +NG +CLDIL+ +WSP   ++ ++
Sbjct:   51 GTFKLVLTFDESYPNKPPTVKFLSKMFHPNVYANGELCLDILQNRWSPTYDVAAIL 106          

HSP 2 Score: 48.521 bits (114), Expect = 2.327e-18
Identity = 18/46 (39.13%), Postives = 29/46 (63.04%), Query Frame = 3
Query:  195 ASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYAD 332
            + KR++++ K L  DPP   S  P A+++  W A I GP+D+P+ D
Sbjct:    5 SKKRLIRDFKRLSTDPPGGISGAPCADNLMIWNAVIFGPADTPFED 50          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC2_MEDSA (Ubiquitin-conjugating enzyme E2 2 OS=Medicago sativa GN=UBC2 PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 2.351e-18
Identity = 28/56 (50.00%), Postives = 41/56 (73.21%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            G F +++ F  DYP KPP V F +++FHPNI ++GSICLDIL+ QWSP   ++ ++
Sbjct:   51 GTFKLSLQFSEDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAIL 106          

HSP 2 Score: 45.4394 bits (106), Expect = 2.351e-18
Identity = 18/44 (40.91%), Postives = 26/44 (59.09%), Query Frame = 3
Query:  195 ASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPY 326
            A KR++++ K LQ DPP   S  P   ++  W A I GP D+P+
Sbjct:    5 ARKRLMRDFKRLQHDPPAGISGAPQDNNIMLWNAVIFGPDDTPW 48          
The following BLAST results are available for this feature:
BLAST of EY659233 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 160
Match NameE-valueIdentityDescription
UBE2B_HUMAN6.320e-1950.00Ubiquitin-conjugating enzyme E2 B OS=Homo sapiens ... [more]
UBE2B_BOVIN6.320e-1950.00Ubiquitin-conjugating enzyme E2 B OS=Bos taurus GN... [more]
UBE2C_DICDI8.219e-1951.85Probable ubiquitin-conjugating enzyme E2 C OS=Dict... [more]
UBC2_ARATH1.390e-1850.00Ubiquitin-conjugating enzyme E2 2 OS=Arabidopsis t... [more]
UBC1_ARATH1.390e-1850.00Ubiquitin-conjugating enzyme E2 1 OS=Arabidopsis t... [more]
UBE2A_MOUSE1.808e-1850.00Ubiquitin-conjugating enzyme E2 A OS=Mus musculus ... [more]
UBE2A_HUMAN1.808e-1850.00Ubiquitin-conjugating enzyme E2 A OS=Homo sapiens ... [more]
UBC1_CAEEL2.324e-1846.43Ubiquitin-conjugating enzyme E2 1 OS=Caenorhabditi... [more]
UBC2_USTMA2.327e-1844.64Ubiquitin-conjugating enzyme E2 2 OS=Ustilago mayd... [more]
UBC2_MEDSA2.351e-1850.00Ubiquitin-conjugating enzyme E2 2 OS=Medicago sati... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-H03-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659233 ID=EY659233|Name=EY659233|organism=Citrus sinensis|type=EST|length=817bp
TCTTTCTCGACGATATTTGTGTTGAAGAACAAAACAGGGGTTGTTAGAGG
AGCGAGGCGGGGGCGGCTTGACGACGTAGATCTGCTTCACCGTTTCGCTT
TCTCGACGCTATTACCCTACGATCCTGTTCTCTGCCGCGCAAGGTCTTAA
GGTTCGTTGTAGCTTTAATTTTAATAACCCCTTGAAGAGTCATGGCTTCA
AAGCGTATTTTGAAGGAACTCAAGGATCTGCAAAAGGATCCTCCCACATC
TTGCAGCGCTGGCCCTGCGGCTGAAGACATGTTCCACTGGCAAGCCACAA
TTATGGGCCCTTCTGATAGCCCATATGCTGATATGCAGGTGTATTTTTAG
TTGCCATTAATTTTCCTCCTGATTATCCTTTCAAGCCCCCAAAGGTTGCT
TTTAGGACCAAGGTCTTCCACCCGAACATCAACAGCAATGGAAGCATCTG
TCTTGATATCCTTAAAGAACAGTGGAGTCCTGCGCTTACCATTTCAAAGA
TGGTGAAGTTGTAAACGAATGCGCGATATAGTGCGGACGATGATTGGTTG
TTGAATACATTTCATGTGATATTGGCCATTCTCAGAACCTAACTCACTCT
GTAAATGCTTGAGCCTTTTGACTAAAGATTATTCAATGTATTGCCGCTGG
AAGATGGTATTGCTNCTGGNAAGTCTGCTGNTGGAATATTTNCATTTTAT
CTTGGNAAGTNNNTGTGGAGAGCTTGGCTCGGTGGCCGGAATTTNNGATA
CTNNTATGGNNAGTTAATGGGAATTTAACTATNGTTTTATATTTGGCATT
CCTTTTTTTTTTATTTA
back to top