EY659232

Overview
NameEY659232
Unique NameEY659232
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length878
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
EY659232_ssr158 microsatellite EY659232_ssr158:158..175. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: NIP42_ARATH (Probable aquaporin NIP4-2 OS=Arabidopsis thaliana GN=NIP4-2 PE=2 SV=2)

HSP 1 Score: 213.001 bits (541), Expect = 1.803e-54
Identity = 110/199 (55.28%), Postives = 139/199 (69.85%), Query Frame = 1
Query:  223 QKLMAEILGTYFMIFAGCASVVVNLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSNIQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYG 816
            QKL+AE++GTYF+IF+GC  VVVN+     ++ PGI + WGL+VMV++YS GHISGAHFNP+VT+  A  +RFPW QVP YI  Q+ GS LA+ TLRL+F      F  T    S+ QA V E II+F LMFVISGVATD+RA GELAG+AVG T++ NV  A PI+GASMN   S G +      KG+W+Y+V    G
Sbjct:   43 QKLIAEMIGTYFIIFSGCGVVVVNVLYGGTITFPGICVTWGLIVMVMIYSTGHISGAHFNPAVTVTFAVFRRFPWYQVPLYIGAQLTGSLLASLTLRLMFNVTPKAFFGTTPTDSSGQALVAEIIISFLLMFVISGVATDSRATGELAGIAVGMTIILNVFVAGPISGASMNPARSLGPAIVMGRYKGIWVYIVGPFVG 241          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: NIP21_ARATH (Aquaporin NIP2-1 OS=Arabidopsis thaliana GN=NIP2-1 PE=2 SV=2)

HSP 1 Score: 210.69 bits (535), Expect = 8.946e-54
Identity = 112/211 (53.08%), Postives = 149/211 (70.62%), Query Frame = 1
Query:  208 SVPFMQKLMAEILGTYFMIFAGCASVVVNLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLF-------QEKQDQFA*TLXAGSNIQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYG 816
            SV F+QKL+AE++GTY++IFAGCA++ VN  +  +V+L GI++VWG+V+MVLVY LGH+S AHFNP+VT+A A+ +RFP  QVP YI  QV+GSTLA+ TLRLLF        +K D F  +  +GS++QAFVMEFIIT +LM V+  V T  R   EL GL +G TV  NV+FA  ++GASMN   S G +      KG+WIY++A   G
Sbjct:   43 SVHFLQKLLAELVGTYYLIFAGCAAIAVNAQHNHVVTLVGIAVVWGIVIMVLVYCLGHLS-AHFNPAVTLALASSQRFPLNQVPAYITVQVIGSTLASATLRLLFDLNNDVCSKKHDVFLGSSPSGSDLQAFVMEFIITGFLMLVVCAVTTTKRTTEELEGLIIGATVTLNVIFAGEVSGASMNPARSIGPALVWGCYKGIWIYLLAPTLG 252          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: NIP14_ORYSJ (Aquaporin NIP1-4 OS=Oryza sativa subsp. japonica GN=NIP1-4 PE=2 SV=1)

HSP 1 Score: 190.274 bits (482), Expect = 1.251e-47
Identity = 91/204 (44.61%), Postives = 134/204 (65.69%), Query Frame = 1
Query:  208 SVPFMQKLMAEILGTYFMIFAGCASVVVNLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSNIQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYG 816
            S  F+Q L+AE L T+F++FAG  ++ V    +  V+ PG+++ WG  VM +VY++GH+SGAH NP+VT+  A   RFPW++ P Y L Q   +T A+  LRL+F  +      TL  G++ Q+ V+EF+ITFYLMFVI  VATD++A+G +AG+AVG T++ NV+FA P++GASMN   S G +        LW+Y++    G
Sbjct:   52 SFTFLQMLLAEFLATFFLMFAGLGAITVE-EKKGAVTFPGVAVAWGAAVMAMVYAVGHVSGAHLNPAVTLGFAVAGRFPWRRAPAYALAQTAAATAASVVLRLMFGGRHAPVPATLPGGAHAQSLVIEFVITFYLMFVIMAVATDDQAVGHMAGVAVGGTIMLNVLFAGPVSGASMNPARSIGPALVGSKYTALWVYILGPFAG 254          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: NIP61_ARATH (Aquaporin NIP6-1 OS=Arabidopsis thaliana GN=NIP6-1 PE=1 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 9.280e-43
Identity = 94/210 (44.76%), Postives = 130/210 (61.90%), Query Frame = 1
Query:  208 SVPFMQKLMAEILGTYFMIFAGCASVVVNLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSNIQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYGDCXAVG 834
            +V   +KL AE +GT  +IFAG A+ +VN   +   +L G +   GL VM+++ S GHISGAH NP+VTIA A  K FPWK VP YI  QV+ S  AA  L+ +F+        T+      QAF +EFII+F LMFV++ VATD RA+GELAG+AVG TV+ N++ A P T ASMN   + G +  + + + +W+Y+ A + G     G
Sbjct:   75 NVSLYRKLGAEFVGTLILIFAGTATAIVNQKTDGAETLIGCAASAGLAVMIVILSTGHISGAHLNPAVTIAFAALKHFPWKHVPVYIGAQVMASVSAAFALKAVFEPTMSGGV-TVPTVGLSQAFALEFIISFNLMFVVTAVATDTRAVGELAGIAVGATVMLNILIAGPATSASMNPVRTLGPAIAANNYRAIWVYLTAPILGALIGAG 283          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: NIP51_ARATH (Probable aquaporin NIP5-1 OS=Arabidopsis thaliana GN=NIP5-1 PE=2 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 4.311e-40
Identity = 92/203 (45.32%), Postives = 125/203 (61.58%), Query Frame = 1
Query:  211 VPFMQKLMAEILGTYFMIFAGCASVVVNLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSNIQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYG 816
            V   +KL AE +GT+ +IF   A  +VN   +   +L G +   GL VM+++ S GHISGAH NPS+TIA A  + FPW  VP YI  QV  S  A+  L+ +F         T+ + S  QAF +EFIITF L+FV++ VATD RA+GELAG+AVG TV+ N++ A P TG SMN   + G +  S + + LW+Y+VA   G
Sbjct:   74 VSLTRKLGAEFVGTFILIFTATAGPIVNQKYDGAETLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAHVPAYIAAQVSASICASFALKGVFHPFMSGGV-TIPSVSLGQAFALEFIITFILLFVVTAVATDTRAVGELAGIAVGATVMLNILVAGPSTGGSMNPVRTLGPAVASGNYRSLWVYLVAPTLG 275          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: NIP31_ORYSJ (Aquaporin NIP3-1 OS=Oryza sativa subsp. japonica GN=NIP3-1 PE=2 SV=2)

HSP 1 Score: 156.377 bits (394), Expect = 2.002e-37
Identity = 93/217 (42.86%), Postives = 122/217 (56.22%), Query Frame = 1
Query:  211 VPFMQKLMAEILGTYFMIFAGCASVVVNLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAG--------SNIQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYGDCXAVG 834
            V   +KL AE +GT+ +IF   A+ +VN      +S  G +   GL V  ++ S GHISGAH NPS+TIA A  + FPW QVP Y+  QVLGS  A   L+ +F          L  G        S  QAF  EFIITF L+FV++ VATD RA+GELAG+AVG  V  N++ A P TG SMN   + G +  + + + LWIY++A   G     G
Sbjct:   79 VSLTRKLGAEFVGTFILIFFATAAPIVNQKYGGAISPFGNAACAGLAVTTIILSTGHISGAHLNPSLTIAFAALRHFPWLQVPAYVAVQVLGSICAGFALKGVFHP-------FLSGGVTVPDPTISTAQAFFTEFIITFNLLFVVTAVATDTRAVGELAGIAVGAAVTLNILIAGPTTGGSMNPVRTLGPAVAAGNYRQLWIYLIAPTLGAVAGAG 288          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: NIP31_MAIZE (Aquaporin NIP3-1 OS=Zea mays GN=NIP3-1 PE=2 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 6.441e-36
Identity = 89/204 (43.63%), Postives = 119/204 (58.33%), Query Frame = 1
Query:  211 VPFMQKLMAEILGTYFMIFAGCASVVVNLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAG-SNIQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYG 816
            V   +KL AE +GT+ +IF   A+ +VN      +S  G +   GL V  ++ S GHISGAH NPS+TIA A  + FPW QVP Y+  Q L S  AA  L+ +F            A  S  QAF  EFII+F L+FV++ VATD RA+GELAG+AVG  V  N++ A P TG SMN   + G +  + + + LWIY++A   G
Sbjct:   70 VSLTRKLGAEFVGTFILIFFATAAPIVNQKYGGAISPFGNAACAGLAVATVILSTGHISGAHLNPSLTIAFAALRHFPWLQVPAYVAVQALASVCAAFALKGVFHPFLSGGVTVPDATVSTAQAFFTEFIISFNLLFVVTAVATDTRAVGELAGIAVGAAVTLNILVAGPTTGGSMNPVRTLGPAVAAGNYRQLWIYLLAPTLG 273          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: NIP22_ORYSJ (Aquaporin NIP2-2 OS=Oryza sativa subsp. japonica GN=NIP2-2 PE=2 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 1.435e-35
Identity = 82/205 (40.00%), Postives = 122/205 (59.51%), Query Frame = 1
Query:  205 FSVPFMQKLMAEILGTYFMIFAGCASVVVNLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSNIQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMNXQESGA-SNCSKSDKGLWIYMVAHLYG 816
            F    ++K+++E++ T+ ++F  C +  +   + K +S  G S+V GL+V V++Y+ GHISGAH NP+VT++ A  + FPW QVP Y   Q  G+  AA  LR +     +    T   G +  A V+E ++TF +MFV   VATD+RA+GELAGLAVG  V    +FA P++G SMN   + A +  S    GLWIY +  + G
Sbjct:   46 FPPNLLKKVISEVVATFLLVFVTCGAASIYGEDMKRISQLGQSVVGGLIVTVMIYATGHISGAHMNPAVTLSFAFFRHFPWIQVPFYWAAQFTGAMCAAFVLRAVLY-PIEVLGTTTPTGPHWHALVIEIVVTFNMMFVTCAVATDSRAVGELAGLAVGSAVCITSIFAGPVSGGSMNPARTLAPAVASNVYTGLWIYFLGPVVG 249          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: NIP21_ORYSJ (Aquaporin NIP2-1 OS=Oryza sativa subsp. japonica GN=NIP2-1 PE=1 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 2.448e-35
Identity = 81/206 (39.32%), Postives = 122/206 (59.22%), Query Frame = 1
Query:  202 YFSVPFMQKLMAEILGTYFMIFAGCASVVVNLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSNIQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYG 816
            +F    ++K+++E++ T+ ++F  C +  ++ ++   +S  G SI  GL+V V++Y++GHISGAH NP+VT+A A  + FPW QVP Y   Q  G+  A+  L+ +     D    T   G +  + V+E I+TF +MFV   VATD RA+GELAGLAVG  V    +FA  I+G SMN   + G +  S    GLWIY +  + G
Sbjct:   42 FFPPHLLKKVVSEVVATFLLVFMTCGAAGISGSDLSRISQLGQSIAGGLIVTVMIYAVGHISGAHMNPAVTLAFAVFRHFPWIQVPFYWAAQFTGAICASFVLKAVI-HPVDVIGTTTPVGPHWHSLVVEVIVTFNMMFVTLAVATDTRAVGELAGLAVGSAVCITSIFAGAISGGSMNPARTLGPALASNKFDGLWIYFLGPVMG 246          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: NIP21_MAIZE (Aquaporin NIP2-1 OS=Zea mays GN=NIP2-1 PE=2 SV=2)

HSP 1 Score: 145.591 bits (366), Expect = 3.534e-34
Identity = 79/205 (38.54%), Postives = 120/205 (58.54%), Query Frame = 1
Query:  205 FSVPFMQKLMAEILGTYFMIFAGCASVVVNLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSNIQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYG 816
            F    ++K+++E++ T+ ++F  C +  +  +++  +S  G S+  GL+V V++Y++GHISGAH NP+VT+A A  + FPW QVP Y   Q  GS  A+  L+ +          T   G +  + V+E I+TF +MFV   VATD RA+GELAGLAVG  V    +FA  ++G SMN   + G +  S    GLWIY +  + G
Sbjct:   41 FPPHLLKKVVSEVVSTFLLVFVTCGAAGIYGSDKDRISQLGQSVAGGLIVTVMIYAVGHISGAHMNPAVTLAFAVFRHFPWIQVPFYWAAQFTGSICASFVLKAVLHPIA-VLGTTTPTGPHWHSLVIEIIVTFNMMFVTLAVATDTRAVGELAGLAVGSAVCITSIFAGAVSGGSMNPARTLGPALASNLYTGLWIYFLGPVLG 244          
The following BLAST results are available for this feature:
BLAST of EY659232 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 137
Match NameE-valueIdentityDescription
NIP42_ARATH1.803e-5455.28Probable aquaporin NIP4-2 OS=Arabidopsis thaliana ... [more]
NIP21_ARATH8.946e-5453.08Aquaporin NIP2-1 OS=Arabidopsis thaliana GN=NIP2-1... [more]
NIP14_ORYSJ1.251e-4744.61Aquaporin NIP1-4 OS=Oryza sativa subsp. japonica G... [more]
NIP61_ARATH9.280e-4344.76Aquaporin NIP6-1 OS=Arabidopsis thaliana GN=NIP6-1... [more]
NIP51_ARATH4.311e-4045.32Probable aquaporin NIP5-1 OS=Arabidopsis thaliana ... [more]
NIP31_ORYSJ2.002e-3742.86Aquaporin NIP3-1 OS=Oryza sativa subsp. japonica G... [more]
NIP31_MAIZE6.441e-3643.63Aquaporin NIP3-1 OS=Zea mays GN=NIP3-1 PE=2 SV=1[more]
NIP22_ORYSJ1.435e-3540.00Aquaporin NIP2-2 OS=Oryza sativa subsp. japonica G... [more]
NIP21_ORYSJ2.448e-3539.32Aquaporin NIP2-1 OS=Oryza sativa subsp. japonica G... [more]
NIP21_MAIZE3.534e-3438.54Aquaporin NIP2-1 OS=Zea mays GN=NIP2-1 PE=2 SV=2[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-H02-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659232 ID=EY659232|Name=EY659232|organism=Citrus sinensis|type=EST|length=878bp
GAATCACTGTGCCTTTGTCTGTCCACTTTGCTCTCCGATCACTGTGCCTT
GATCCTATATAGATAGATCATGGCCGATAATTCAGGGACAGGGAGCAATG
GAGTTTGTGTAACATTCAAAGATTGTGAAGATGCCATTCAGAATTGCCCT
TCCTCTGCTCCTCCTCCTCCTCCTCCTTCATGCGACACAAAGGACTCCGT
ATATTTTTCAGTACCCTTCATGCAAAAGTTGATGGCGGAGATTTTGGGGA
CATATTTTATGATATTCGCGGGATGTGCATCGGTGGTGGTGAATCTGAAC
AATGAAAAGATAGTGTCGCTTCCAGGAATATCAATTGTGTGGGGACTTGT
TGTGATGGTGCTTGTTTACTCCCTCGGTCACATCTCCGGCGCCCATTTCA
ATCCTTCTGTCACCATTGCTCATGCCACCTGCAAACGTTTTCCCTGGAAA
CAGGTTCCGCCTTATATACTATGCCAAGTTCTGGGATCAACGTTGGCTGC
GGGAACACTTCGGTTACTGTTTCAAGAAAAACAGGATCAGTTCGCATGAA
CACTTNCAGCTGGCTCCAATATTCAGGCGTTTGTGATGGAGTTCATTATC
ACCTTCTACCTCATGTTTGTCATATCCGGTGTCGCCACCGATAACAGAGC
TATAGGCGAGCTTGCAGGTCTCGCTGTTGGTTTCACAGTGCTTGCTAATG
TCATGTTTGCCCGGCCCATAACAGGAGCATCAATGAACCANCAAGAATCT
GGGGCCAGCAATTGTTCAAAGTCAGACAAGGGTTTGTGGATATACATGGT
GGCGCACCTTTATGGCGACTGCANGGCCGTGGGTTACAAATGGGGGAAAT
TTCTGACAGCCTTTGGGAAAATTACAAA
back to top