EY659232

Overview
NameEY659232
Unique NameEY659232
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length878
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
EY659232_ssr158 microsatellite EY659232_ssr158:158..175. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: NIP33_ORYSJ (Aquaporin NIP3-3 OS=Oryza sativa subsp. japonica GN=NIP3-3 PE=2 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 4.616e-34
Identity = 81/210 (38.57%), Postives = 126/210 (60.00%), Query Frame = 1
Query:  208 SVPFMQKLMAEILGTYFMIFAGCASVVVNLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSNIQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYGDCXAVG 834
            SVP ++K+ AE  GT+ +IF   ++++++  ++ I +L GI+   GL V VLV SL HISG H NP+++IA A     P   + PYI  Q+LG+  A+  ++ L+         T+     ++AF +EFIITF+L+F+I+ +ATD  A+ EL  +AVG TV+ N++ A P TGASMN   + GA+  +     +W+Y+VA   G     G
Sbjct:   63 SVPLLKKVSAEFFGTFILIFTVLSTIIMDEQHKSIETLLGIATSAGLAVTVLVLSLIHISGCHLNPAISIAMAVFGHLPSAHLLPYISSQILGAVAASFAVKGLYHPVNPGIV-TVPNVGTVEAFFVEFIITFFLLFIITALATDPNAVKELIAVAVGATVMMNILVAGPSTGASMNPARTIGAAIATGRYTQIWVYLVATPLGAIAGTG 271          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: NIP23_MAIZE (Aquaporin NIP2-3 OS=Zea mays GN=NIP2-3 PE=2 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 4.616e-34
Identity = 78/199 (39.20%), Postives = 118/199 (59.30%), Query Frame = 1
Query:  223 QKLMAEILGTYFMIFAGCASVVVNLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSNIQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMNXQESGA-SNCSKSDKGLWIYMVAHLYG 816
            +K+++E++ T+ ++F  C +  +   +   +S  G S+  GL+V V++Y+ GHISGAH NP+VT++ A  + FPW QVP Y   Q  G+  AA  L+ + Q        T  +G +  A  +E ++TF +MFV   VATD+RA+GELAGLAVG  V    +FA P++G SMN   + A +  S    GLWIY +  + G
Sbjct:   55 KKVISEVVATFLLVFVTCGAASIYGEDNARISQLGQSVAGGLIVTVMIYATGHISGAHMNPAVTLSFACFRHFPWIQVPFYWAAQFTGAMCAAFVLKAVLQPIA-VIGTTTPSGPHWHALAIEIVVTFNMMFVTCAVATDSRAVGELAGLAVGSAVCITSIFAGPVSGGSMNPARTLAPAVASNVFTGLWIYFLGPVVG 252          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: NIP22_MAIZE (Aquaporin NIP2-2 OS=Zea mays GN=NIP2-2 PE=2 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 6.029e-34
Identity = 77/199 (38.69%), Postives = 119/199 (59.80%), Query Frame = 1
Query:  223 QKLMAEILGTYFMIFAGCASVVVNLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSNIQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMNXQESGA-SNCSKSDKGLWIYMVAHLYG 816
            +K+++E++ T+ ++F  C +  +   + + +S  G S+  GL+V V++Y+ GHISGAH NP+VT++ A  + FPW QVP Y   Q  G+  AA  L+ +          T  +G +  A ++E ++TF +MFV   VATD+RA+GELAGLAVG  V    +FA P++G SMN   + A +  S    GLWIY +  + G
Sbjct:   52 KKVISEVVATFLLVFVTCGAASIYGEDNRRISQLGQSVAGGLIVTVMIYATGHISGAHMNPAVTLSFACFRHFPWIQVPFYWAAQFTGAMCAAFVLKAVLHPIA-VIGTTTPSGPHWHALLIEIVVTFNMMFVTCAVATDSRAVGELAGLAVGSAVCITSIFAGPVSGGSMNPARTLAPAVASNVFTGLWIYFLGPVIG 249          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: NIP32_ORYSJ (Aquaporin NIP3-2 OS=Oryza sativa subsp. japonica GN=NIP3-2 PE=2 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 6.239e-31
Identity = 76/210 (36.19%), Postives = 121/210 (57.62%), Query Frame = 1
Query:  211 VPFMQKLMAEILGTYFMIFAGCASVVVNLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSNIQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYGDCXAVGY 837
            VP ++K+ AE  GT+ +IF   ++++++  ++ + SL GI+   GL V VLV SL HISG H NP+V+IA       P   + PYI  Q+LGS  A+  ++ ++         T+     ++AF +EF+ TF L+F+I+ +ATD  A+ EL  +AVG T++ N + A P TGASMN   + G +  +     +W+Y+VA   G     G+
Sbjct:   91 VPLVKKVGAEFFGTFTLIFTVLSTIIMDEQHKGVESLLGIATSAGLAVTVLVLSLIHISGCHLNPAVSIAMTVFGHLPPAHLLPYIAAQILGSITASFAVKGMYHPVNPGIV-TVPKVGTVEAFFLEFVTTFVLLFIITALATDPNAVKELIAVAVGATIMMNALVAGPSTGASMNPARTLGPAIATGRYTQIWVYLVATPLGAVAGEGF 299          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: NIP71_ARATH (Probable aquaporin NIP7-1 OS=Arabidopsis thaliana GN=NIP7-1 PE=2 SV=2)

HSP 1 Score: 122.479 bits (306), Expect = 3.204e-27
Identity = 75/198 (37.88%), Postives = 110/198 (55.56%), Query Frame = 1
Query:  229 LMAEILGTYFMIFAGCASVVVNLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSNIQAFVMEFIITFYLMFVISGV-ATDNRAIGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYG 816
            +MAE++GT+ ++F+ C  +     +   V L   ++  GL V+V+VYS+GHISGAH NPS+TIA A    FPW QVP YI  Q LG+T A      ++    D  A T  A S + AF +E I T  ++F+ S +    ++ +G L G  +G  +   V+   PI+G SMN   S G +  +   + LWIYM A + G
Sbjct:   48 VMAELVGTFILMFSVCGVISSTQLSGGHVGLLEYAVTAGLSVVVVVYSIGHISGAHLNPSITIAFAVFGGFPWSQVPLYITAQTLGATAATLVGVSVYGVNADIMA-TKPALSCVSAFFVELIATSIVVFLASALHCGPHQNLGNLTGFVIGTVISLGVLITGPISGGSMNPARSLGPAVVAWDFEDLWIYMTAPVIG 244          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQPZ_RHOPA (Aquaporin Z OS=Rhodopseudomonas palustris GN=aqpZ PE=3 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 1.031e-25
Identity = 74/213 (34.74%), Postives = 112/213 (52.58%), Query Frame = 1
Query:  226 KLMAEILGTYFMIFAGCASVVVNLNNEKI-VSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSN------------IQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMNXQESGASNCSKSDKG---LWIYMVAHLYG 816
            K +AE++GT+++ FAGC S V+     ++ + L G+S+ +GL V+ + Y++GHISG H NP+VT+  A   RFP KQ+ PYI+ QVLG+ +AA  L  L       F       SN            +  FVME ++T   +FVI G +T  +A    A LA+G  ++   + + P+T  S+N   S              LW++ VA L G
Sbjct:    5 KYLAEMIGTFWLTFAGCGSAVIAAGFPQVGIGLVGVSLAFGLSVVTMAYAIGHISGCHLNPAVTLGLAAGGRFPVKQIAPYIIAQVLGA-IAAAALLYLIASGAAGFDLAKGFASNGYGAHSPGQYNLVACFVMEVVMTMMFLFVIMG-STHGKAPAGFAPLAIGLALVMIHLVSIPVTNTSVNPARSTGPALFVGGWAIGQLWLFWVAPLLG 215          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQPZ_BRAJA (Aquaporin Z OS=Bradyrhizobium japonicum GN=aqpZ PE=3 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 1.944e-24
Identity = 74/225 (32.89%), Postives = 116/225 (51.56%), Query Frame = 1
Query:  220 MQKLMAEILGTYFMIFAGCASVVVNLNNEKI-VSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSN------------IQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMNXQESGASNC---SKSDKGLWIYMVAHLYGDC-XAVGYKW 843
            M+K  AE +GT+++ FAGC S V+     ++ + L G+S+ +GL V+ + Y++GHISG H NP+VT+  A   RFP  Q+ PY++ QV G+ +AA  L ++       F  T    SN            +  F+ E ++T   +F+I G AT  RA    A LA+G  ++   + + P+T  S+N   S          +   LW++ VA L G     V Y+W
Sbjct:    3 MKKYAAEAIGTFWLTFAGCGSAVIAAGFPQVGIGLVGVSLAFGLSVVTMAYAIGHISGCHLNPAVTVGLAAGGRFPAGQILPYVIAQVCGAIVAAELLYII-ASGAPGFDVTKGFASNGYDAHSPGQYSMMACFLTEVVMTMMFLFIIMG-ATHGRAPAGFAPLAIGLALVMIHLVSIPVTNTSVNPARSTGPALFVGGWAMAQLWLFWVAPLIGGALGGVIYRW 225          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQPZ_PHOLL (Aquaporin Z OS=Photorhabdus luminescens subsp. laumondii GN=aqpZ PE=3 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 2.539e-24
Identity = 75/215 (34.88%), Postives = 113/215 (52.56%), Query Frame = 1
Query:  220 MQKLMAEILGTYFMIFAGCASVVVNLNNEKI-VSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSN------------IQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMNXQESGASNCSKSD---KGLWIYMVAHLYG 816
            ++KL AE+LGT+ ++F GC SVV      ++ +   G+S+ +GL V+ ++Y++GHISG HFNP+VTI      RF   +V PYI+ QV+G  LAA  L ++   +    A T    SN              A V E ++T   + VI G ATD RA    A LA+G  ++   + + PIT  S+N   S A    ++    + LW + V  + G
Sbjct:    2 LRKLAAELLGTFVLVFGGCGSVVFAAAFPELGIGFVGVSLAFGLTVLTMIYAVGHISGGHFNPAVTIGLWAGGRFRAVEVIPYIISQVIGGILAAAVLYVIASGQVGFDATTSGFASNGFGEHSPGGFSLQSAIVAEIVLTAIFLIVIIG-ATDRRAPPGFAPLAIGLALVLINLISIPITNTSVNPARSTAVAIFQNTWALEQLWFFWVMPIIG 215          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQPZ_BORPA (Aquaporin Z OS=Bordetella parapertussis GN=aqpZ PE=3 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 9.648e-24
Identity = 68/217 (31.34%), Postives = 111/217 (51.15%), Query Frame = 1
Query:  214 PFMQKLMAEILGTYFMIFAGCASVVVNLNNEKI-VSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQ--DQFA*TLXAG----------SNIQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMNXQESGASNCSKSD---KGLWIYMVAHLYG 816
            P  ++  AE  GT++++  GC S V+     ++ +   G+++ +GL V+ + Y++GHISG HFNP+VT+  A   RF W+ VPPYI+ QV+G+ +AA TL  + Q     D  A    A           S   A + E +++   +FVI G ATD RA    A + +G  +    + + P+T  S+N   S            + LW++ +A + G
Sbjct:    3 PLFKRCGAEFFGTFWLVLGGCGSAVLAAGVPQVGIGYAGVALAFGLTVLTMAYAVGHISGGHFNPAVTVGLAASGRFGWRDVPPYIVAQVVGAIVAAATLASIAQGVAGFDLVASKFAANGYGDHSPGKYSMQAALICEIVLSAGFVFVILG-ATDKRAPAGFAPIPIGLALTLIHLISIPVTNTSVNPARSTGPALFVGGWALEQLWLFWLAPIAG 218          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQPZ_BORBR (Aquaporin Z OS=Bordetella bronchiseptica GN=aqpZ PE=3 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 9.648e-24
Identity = 68/217 (31.34%), Postives = 111/217 (51.15%), Query Frame = 1
Query:  214 PFMQKLMAEILGTYFMIFAGCASVVVNLNNEKI-VSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQ--DQFA*TLXAG----------SNIQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMNXQESGASNCSKSD---KGLWIYMVAHLYG 816
            P  ++  AE  GT++++  GC S V+     ++ +   G+++ +GL V+ + Y++GHISG HFNP+VT+  A   RF W+ VPPYI+ QV+G+ +AA TL  + Q     D  A    A           S   A + E +++   +FVI G ATD RA    A + +G  +    + + P+T  S+N   S            + LW++ +A + G
Sbjct:    3 PLFKRCGAEFFGTFWLVLGGCGSAVLAAGVPQVGIGYAGVALAFGLTVLTMAYAVGHISGGHFNPAVTVGLAASGRFGWRDVPPYIVAQVVGAIVAAATLASIAQGVAGFDLVASKFAANGYGDHSPGKYSMQAALICEIVLSAGFVFVILG-ATDKRAPAGFAPIPIGLALTLIHLISIPVTNTSVNPARSTGPALFVGGWALEQLWLFWLAPIAG 218          
The following BLAST results are available for this feature:
BLAST of EY659232 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 137
Match NameE-valueIdentityDescription
NIP33_ORYSJ4.616e-3438.57Aquaporin NIP3-3 OS=Oryza sativa subsp. japonica G... [more]
NIP23_MAIZE4.616e-3439.20Aquaporin NIP2-3 OS=Zea mays GN=NIP2-3 PE=2 SV=1[more]
NIP22_MAIZE6.029e-3438.69Aquaporin NIP2-2 OS=Zea mays GN=NIP2-2 PE=2 SV=1[more]
NIP32_ORYSJ6.239e-3136.19Aquaporin NIP3-2 OS=Oryza sativa subsp. japonica G... [more]
NIP71_ARATH3.204e-2737.88Probable aquaporin NIP7-1 OS=Arabidopsis thaliana ... [more]
AQPZ_RHOPA1.031e-2534.74Aquaporin Z OS=Rhodopseudomonas palustris GN=aqpZ ... [more]
AQPZ_BRAJA1.944e-2432.89Aquaporin Z OS=Bradyrhizobium japonicum GN=aqpZ PE... [more]
AQPZ_PHOLL2.539e-2434.88Aquaporin Z OS=Photorhabdus luminescens subsp. lau... [more]
AQPZ_BORPA9.648e-2431.34Aquaporin Z OS=Bordetella parapertussis GN=aqpZ PE... [more]
AQPZ_BORBR9.648e-2431.34Aquaporin Z OS=Bordetella bronchiseptica GN=aqpZ P... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-H02-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659232 ID=EY659232|Name=EY659232|organism=Citrus sinensis|type=EST|length=878bp
GAATCACTGTGCCTTTGTCTGTCCACTTTGCTCTCCGATCACTGTGCCTT
GATCCTATATAGATAGATCATGGCCGATAATTCAGGGACAGGGAGCAATG
GAGTTTGTGTAACATTCAAAGATTGTGAAGATGCCATTCAGAATTGCCCT
TCCTCTGCTCCTCCTCCTCCTCCTCCTTCATGCGACACAAAGGACTCCGT
ATATTTTTCAGTACCCTTCATGCAAAAGTTGATGGCGGAGATTTTGGGGA
CATATTTTATGATATTCGCGGGATGTGCATCGGTGGTGGTGAATCTGAAC
AATGAAAAGATAGTGTCGCTTCCAGGAATATCAATTGTGTGGGGACTTGT
TGTGATGGTGCTTGTTTACTCCCTCGGTCACATCTCCGGCGCCCATTTCA
ATCCTTCTGTCACCATTGCTCATGCCACCTGCAAACGTTTTCCCTGGAAA
CAGGTTCCGCCTTATATACTATGCCAAGTTCTGGGATCAACGTTGGCTGC
GGGAACACTTCGGTTACTGTTTCAAGAAAAACAGGATCAGTTCGCATGAA
CACTTNCAGCTGGCTCCAATATTCAGGCGTTTGTGATGGAGTTCATTATC
ACCTTCTACCTCATGTTTGTCATATCCGGTGTCGCCACCGATAACAGAGC
TATAGGCGAGCTTGCAGGTCTCGCTGTTGGTTTCACAGTGCTTGCTAATG
TCATGTTTGCCCGGCCCATAACAGGAGCATCAATGAACCANCAAGAATCT
GGGGCCAGCAATTGTTCAAAGTCAGACAAGGGTTTGTGGATATACATGGT
GGCGCACCTTTATGGCGACTGCANGGCCGTGGGTTACAAATGGGGGAAAT
TTCTGACAGCCTTTGGGAAAATTACAAA
back to top