EY659232

Overview
NameEY659232
Unique NameEY659232
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length878
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
EY659232_ssr158 microsatellite EY659232_ssr158:158..175. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: TIP22_MAIZE (Aquaporin TIP2-2 OS=Zea mays GN=TIP2-2 PE=2 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.948e-16
Identity = 63/212 (29.72%), Postives = 100/212 (47.17%), Query Frame = 1
Query:  205 FSVPFMQKLMAEILGTYFMIFAGCASVVV--NLNNEKIVSLPG---ISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSNIQAFVMEFIITFYLMFVISGVATDNR--AIGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYG 816
            FSV  ++  +AE + T   +FAG  S +    L N   +   G   I++   L + V V    + SG H NP+VT   A            Y + Q+LG+++A   LR +   K           + ++  V E +ITF L++ +   A D +  ++G +A +A+GF V AN++ A P +G SMN   S G +  +    G W+Y V  L G
Sbjct:   13 FSVTSIKAYVAEFIATLLFVFAGVGSAIAFGQLTNGGALDPAGLVAIAVAHALALFVGVSVAANTSGGHLNPAVTFGLAVGGHITVLTGLFYWVAQLLGASVACLLLRFVTHGKAIPTHGVSGGTTELEGVVFEIVITFALVYTVYATAADPKKGSLGTIAPIAIGFIVGANILAAGPFSGGSMNPARSFGPAVAAADFAGNWVYWVGPLIG 224          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: TIP21_ORYSJ (Probable aquaporin TIP2-1 OS=Oryza sativa subsp. japonica GN=TIP2-1 PE=2 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.948e-16
Identity = 65/212 (30.66%), Postives = 103/212 (48.58%), Query Frame = 1
Query:  205 FSVPFMQKLMAEILGTYFMIFAGCASVVV--NLNNEKIVSLPG---ISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSNIQAFVMEFIITFYLMFVISGVATDNR--AIGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYG 816
            FS   ++  +AE + T   +FAG  S +    L N   +   G   I+I   L + V V    +ISG H NP+VT   A            Y + Q+LG+++A   L+ +   K       +   S ++  VME +ITF L++ +   A D +  ++G +A +A+GF V AN++ A P +G SMN   S G +  + +  G W+Y V  L G
Sbjct:   13 FSATSVKAYVAEFIATLLFVFAGVGSAIAYGQLTNGGALDPAGLVAIAIAHALALFVGVSVAANISGGHLNPAVTFGLAVGGHITILTGLFYWIAQLLGASIACLLLKFVTHGKAIPTH-GVAGISELEGVVMEIVITFALVYTVYATAADPKKGSLGTIAPIAIGFIVGANILAAGPFSGGSMNPARSFGPAVAAGNFAGNWVYWVGPLIG 223          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQPB_DICDI (Aquaporin B OS=Dictyostelium discoideum GN=wacA PE=2 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.948e-16
Identity = 68/223 (30.49%), Postives = 110/223 (49.33%), Query Frame = 1
Query:  217 FMQKLMAEILGTYFMIFAGCASVVVN--LNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQE--KQDQFA*TLXAGSNI-QAFVMEFIITFYLMFVISGVATDNR---AIGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYGDCXAVGYKWGKFLT 858
            F ++L+AE  GT F+++    S +      ++ IV +  I +V G     +++S+  ISG   NP+VT+   T  R        +I+ Q +G+ + AG ++       ++D  A TL  G N+ + F +E + T +L+FV+ GVA  N     I  +A LA+G  V+A V F    TG S+N   S G +  S +    +IY    + G   A G  W  FL+
Sbjct:   30 FTRQLLAEFFGTLFVVYIVSGSTLAANFAVSDPIVRVCLICLVQGFAFAAIIWSISGISGCQLNPAVTVGCVTTGRMGILNGIAFIIFQCVGALVGAGMMKASLPTFYERDLSATTLATGVNVARGFFLEMVTTSFLVFVVLGVAVYNEWDPKISRVAPLAIGCAVIAGVGFLNLFTGGSLNPARSFGPAVFSDTWHRHYIYWFGPICGGIIA-GLFWRIFLS 251          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQP4_MOUSE (Aquaporin-4 OS=Mus musculus GN=Aqp4 PE=2 SV=2)

HSP 1 Score: 86.2705 bits (212), Expect = 2.545e-16
Identity = 67/208 (32.21%), Postives = 96/208 (46.15%), Query Frame = 1
Query:  217 FMQKLMAEILGTYFMIFAGCASVVV--NLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSNIQA---FVMEFIITFYLMFVISGVATDNR--AIGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYG 816
            F + + AE L T   +  G  S +      N   V +  IS+ +GL +  +V   GHISG H NP+VT+A    ++    +   YI+ Q LG+ + AG L L+                N+ A    ++E IITF L+F I       R    G +A LA+GF+V    +FA   TGASMN   S G +    +    WIY V  + G
Sbjct:   34 FWKAVSAEFLATLIFVLLGVGSTINWGGSENPLPVDMVLISLCFGLSIATMVQCFGHISGGHINPAVTVAMVCTRKISIAKSVFYIIAQCLGAIIGAGILYLVTPPSVVGGLGVTTVHGNLTAGHGLLVELIITFQLVFTIFASCDSKRTDVTGSIA-LAIGFSVAIGHLFAINYTGASMNPARSFGPAVIMGNWANHWIYWVGPIMG 240          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: TIP21_MAIZE (Aquaporin TIP2-1 OS=Zea mays GN=TIP2-1 PE=2 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 5.669e-16
Identity = 68/213 (31.92%), Postives = 101/213 (47.42%), Query Frame = 1
Query:  205 FSVPFMQKLMAEILGTYFMIFAGCASVVV--NLNNEKIVSLPG---ISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAG-SNIQAFVMEFIITFYLMFVISGVATDNR--AIGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYG 816
            FS   ++  +AE + T   +FAG  S +    L N   +   G   I+I   L + V V    +ISG H NP+VT   A            Y + Q+LG+T+A   L L F            AG S ++  V E +ITF L++ +   A D +  ++G +A +A+GF V AN++ A P +G SMN   S G +  +    G W+Y V  L G
Sbjct:   13 FSATSIKAYVAEFIATLLFVFAGVGSAIAYGQLTNGGALDPAGLVAIAIAHALALFVGVSVAANISGGHLNPAVTFGLAVGGHITILTGVFYWVAQLLGATVAC--LLLGFVTHGKAIPTHAVAGISELEGVVFEVVITFALVYTVYATAADPKKGSLGTIAPIAIGFIVGANILAAGPFSGGSMNPARSFGPAVAAGDFAGNWVYWVGPLVG 223          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: TIP23_ARATH (Aquaporin TIP2-3 OS=Arabidopsis thaliana GN=TIP2-3 PE=1 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 7.404e-16
Identity = 65/216 (30.09%), Postives = 100/216 (46.30%), Query Frame = 1
Query:  205 FSVPFMQKLMAEILGTYFMIFAGCASVVV--NLNNEKIVSLPG---ISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSNIQAFVMEFIITFYLMFVISGVATDNR--AIGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYGDCXA 828
            FSV  ++  ++E + T   +FAG  S V    L ++  +   G   I+I     + V V    +ISG H NP+VT+  A            Y + Q LGS +A   L  +   K             ++  VME ++TF L++ +   A D +  ++G +A +A+GF V AN++ A P +G SMN   S G +  S     +WIY V  L G   A
Sbjct:   13 FSVSSLKAYLSEFIATLLFVFAGVGSAVAFAKLTSDGALDPAGLVAIAIAHAFALFVGVSIAANISGGHLNPAVTLGLAIGGNITLITGFFYWIAQCLGSIVACLLLVFVTNGKSVPTHGVSAGLGAVEGVVMEIVVTFALVYTVYATAADPKKGSLGTIAPIAIGFIVGANILAAGPFSGGSMNPARSFGPAVVSGDLSQIWIYWVGPLVGGALA 228          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQP_DROME (Aquaporin OS=Drosophila melanogaster GN=Drip PE=1 SV=2)

HSP 1 Score: 84.7297 bits (208), Expect = 7.404e-16
Identity = 63/205 (30.73%), Postives = 96/205 (46.83%), Query Frame = 1
Query:  229 LMAEILGTYFMIFAGCASVVVNLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQ--EKQDQFA*TLXAGSN-IQAFVMEFIITFYLMFVISGVATDNRA-IGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYGDCXA 828
            L+ E++GT+F+IF G  S           S+P I+  +GL V  +   LGH+SG H NP+VT+           +   YI+ Q +G+   A  +++        D    +     N  QA ++E +ITF L+FV+  V+   R  I   A LAVG  + A  + A  ++GASMN   S G +         W+Y V  + G   A
Sbjct:   26 LLGELVGTFFLIFVGVGSTTSG-------SVPQIAFTFGLTVATIAQGLGHLSGCHINPAVTLGFLIVGEISILKAAFYIIVQCVGAIAGAAVIKVALDGVAGGDLGVSSFDPSLNCAQAVLIEALITFILVFVVKAVSDPGRQDIKGSAPLAVGLAIAAGHLCAIKLSGASMNPARSFGPAVVQGVWTYHWVYWVGPIAGGLLA 223          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQP8_MOUSE (Aquaporin-8 OS=Mus musculus GN=Aqp8 PE=2 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 7.404e-16
Identity = 50/186 (26.88%), Postives = 97/186 (52.15%), Query Frame = 1
Query:  199 VYFSVPFMQKLMAEILGTYFMIFAGCASVVVNLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQ------DQFA*TLXAGSNIQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMN 738
            V++   ++Q  + E++G+   IF GC SV+ N  N  ++     ++  GL + +++ +LG+ISG HFNP+V++A           + PY + Q+ G  + A   +++  E++        FA         +A  +E I+T  L+  +   A + + +G LA  ++GF+V+ +++    I+GA MN
Sbjct:   28 VFWYEQYVQPCIVELVGSALFIFIGCLSVIENSPNTGLLQP---ALAHGLALGLIIATLGNISGGHFNPAVSLAVTVIGGLKTMLLIPYWISQLFGGLIGAALAKVVSPEERFWNASGAAFAIVQEQEQVAEALGIEIILTMLLVLAVCMGAVNEKTMGPLAPFSIGFSVIVDILAGGSISGACMN 210          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: AQP8_HUMAN (Aquaporin-8 OS=Homo sapiens GN=AQP8 PE=2 SV=2)

HSP 1 Score: 83.9593 bits (206), Expect = 1.263e-15
Identity = 57/205 (27.80%), Postives = 98/205 (47.80%), Query Frame = 1
Query:  217 FMQKLMAEILGTYFMIFAGCASVVVNLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQ------DQFA*TLXAGSNIQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHL 810
            F+Q  + E+LG+   IF GC SV+ N  +  ++     ++  GL + +++ +LG+ISG HFNP+V++A           + PY + Q+LG  L A   + +  E++        F      G    A V E I+T  L   +   A + +  G LA  ++GF V  +++   P++G  MN   + G +  +      WIY +  L
Sbjct:   34 FVQPCLVELLGSALFIFIGCLSVIENGTDTGLLQP---ALAHGLALGLVIATLGNISGGHFNPAVSLAAMLIGGLNLVMLLPYWVSQLLGGMLGAALAKAVSPEERFWNASGAAFVTVQEQGQVAGALVAEIILTTLLALAVCMGAINEKTKGPLAPFSIGFAVTVDILAGGPVSGGCMNPARAFGPAVVANHWNFHWIYWLGPL 235          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: TIP1_TOBAC (Probable aquaporin TIP-type RB7-5A OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 1.649e-15
Identity = 66/222 (29.73%), Postives = 104/222 (46.85%), Query Frame = 1
Query:  205 FSVPFMQKLMAEILGTYFMIFAGCASVVV--NLNNEKIVSLPG---ISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSNIQAFVMEFIITFYLMFVISGVATDNR--AIGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYGDCXAVGYKWG 846
            FSV  ++  +AE + T   +FAG  S +    L  +  +   G   +++     + V V    +ISG H NP+VT+  A            Y + Q+LGST+A   L+ +               + +Q  VME IITF L++ +   A D +  ++G +A +A+GF V AN++ A P +G SMN   S G +  +      WIY    L G   A G+ +G
Sbjct:   13 FSVGSLKAYVAEFIATLLFVFAGVGSAIAYNKLTADAALDPAGLVAVAVAHAFALFVGVSIAANISGGHLNPAVTLGLAVGGNITILTGFFYWIAQLLGSTVACLLLKYVTNGLAVPTHGVAAGLNGLQGVVMEIIITFALVYTVYATAADPKKGSLGTIAPIAIGFIVGANILAAGPFSGGSMNPARSFGPAVVAGDFSQNWIYWAGPLIGGGLA-GFIYG 233          
The following BLAST results are available for this feature:
BLAST of EY659232 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 137
Match NameE-valueIdentityDescription
TIP22_MAIZE1.948e-1629.72Aquaporin TIP2-2 OS=Zea mays GN=TIP2-2 PE=2 SV=1[more]
TIP21_ORYSJ1.948e-1630.66Probable aquaporin TIP2-1 OS=Oryza sativa subsp. j... [more]
AQPB_DICDI1.948e-1630.49Aquaporin B OS=Dictyostelium discoideum GN=wacA PE... [more]
AQP4_MOUSE2.545e-1632.21Aquaporin-4 OS=Mus musculus GN=Aqp4 PE=2 SV=2[more]
TIP21_MAIZE5.669e-1631.92Aquaporin TIP2-1 OS=Zea mays GN=TIP2-1 PE=2 SV=1[more]
TIP23_ARATH7.404e-1630.09Aquaporin TIP2-3 OS=Arabidopsis thaliana GN=TIP2-3... [more]
AQP_DROME7.404e-1630.73Aquaporin OS=Drosophila melanogaster GN=Drip PE=1 ... [more]
AQP8_MOUSE7.404e-1626.88Aquaporin-8 OS=Mus musculus GN=Aqp8 PE=2 SV=1[more]
AQP8_HUMAN1.263e-1527.80Aquaporin-8 OS=Homo sapiens GN=AQP8 PE=2 SV=2[more]
TIP1_TOBAC1.649e-1529.73Probable aquaporin TIP-type RB7-5A OS=Nicotiana ta... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-H02-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659232 ID=EY659232|Name=EY659232|organism=Citrus sinensis|type=EST|length=878bp
GAATCACTGTGCCTTTGTCTGTCCACTTTGCTCTCCGATCACTGTGCCTT
GATCCTATATAGATAGATCATGGCCGATAATTCAGGGACAGGGAGCAATG
GAGTTTGTGTAACATTCAAAGATTGTGAAGATGCCATTCAGAATTGCCCT
TCCTCTGCTCCTCCTCCTCCTCCTCCTTCATGCGACACAAAGGACTCCGT
ATATTTTTCAGTACCCTTCATGCAAAAGTTGATGGCGGAGATTTTGGGGA
CATATTTTATGATATTCGCGGGATGTGCATCGGTGGTGGTGAATCTGAAC
AATGAAAAGATAGTGTCGCTTCCAGGAATATCAATTGTGTGGGGACTTGT
TGTGATGGTGCTTGTTTACTCCCTCGGTCACATCTCCGGCGCCCATTTCA
ATCCTTCTGTCACCATTGCTCATGCCACCTGCAAACGTTTTCCCTGGAAA
CAGGTTCCGCCTTATATACTATGCCAAGTTCTGGGATCAACGTTGGCTGC
GGGAACACTTCGGTTACTGTTTCAAGAAAAACAGGATCAGTTCGCATGAA
CACTTNCAGCTGGCTCCAATATTCAGGCGTTTGTGATGGAGTTCATTATC
ACCTTCTACCTCATGTTTGTCATATCCGGTGTCGCCACCGATAACAGAGC
TATAGGCGAGCTTGCAGGTCTCGCTGTTGGTTTCACAGTGCTTGCTAATG
TCATGTTTGCCCGGCCCATAACAGGAGCATCAATGAACCANCAAGAATCT
GGGGCCAGCAATTGTTCAAAGTCAGACAAGGGTTTGTGGATATACATGGT
GGCGCACCTTTATGGCGACTGCANGGCCGTGGGTTACAAATGGGGGAAAT
TTCTGACAGCCTTTGGGAAAATTACAAA
back to top