EY659229

Overview
NameEY659229
Unique NameEY659229
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length909
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: FABG_RICFE (3-oxoacyl-[acyl-carrier-protein] reductase OS=Rickettsia felis GN=fabG PE=3 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 8.360e-18
Identity = 68/236 (28.81%), Postives = 116/236 (49.15%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPG 709
            TGAS G+G      L K G  ++ +    ++LKSL + +            +E+   AN     N +  A     ++D LV NAG++    + + + +E+++ ++  NL  ++++++    +M   N+ G +INISSI   S    PG   Y +SKAGL  MTK LS E+    I VN++ PG  KS++T+ L +K        +  PL  +G  +  + + V +L  D +    G
Sbjct:   12 TGASGGIGGAIARLLHKLGSHVIISGSNEEKLKSLGNVLKDN-------YTIEICNLANKEECSNLISKA----PKLDILVCNAGITSDTLA-IRMKDEDFDKVIDINLKANFILNREAIKKMMQ-NRYGRIINISSIVGISGN--PGQANYCASKAGLIGMTKSLSYEVATRGITVNAVAPGFIKSDMTDKLNEKQ--REAIVQKIPLGTYGMPED-VANAVAFLASDQASYITG 229          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: DHG2_BACME (Glucose 1-dehydrogenase 2 OS=Bacillus megaterium GN=gdhII PE=3 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 8.360e-18
Identity = 66/190 (34.74%), Postives = 101/190 (53.16%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAAR-RVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEI 568
            TG S GLGR   +   +   ++V   R   +    +  EI +  G   +A+ V  DV+     + N V+ A + FG +D ++NNAGV   V S  +L+ E WN ++ TNLTG++L S+       + + +G+VIN+SS+        P  V YA+SK G+  MT+ L+LE     IRVN+I PG   + I
Sbjct:   13 TGGSKGLGRAMAVRFGQEQSKVVVNYRSNEEEALEVKKEIEEAGG---QAIIVRGDVTKEEDVV-NLVETAVKEFGSLDVMINNAGVENPVPSH-ELSLENWNQVIDTNLTGAFLGSREAIKYFVENDIKGNVINMSSVHEMI--PWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAIDTPI 195          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: BDHA_RHIME (D-beta-hydroxybutyrate dehydrogenase OS=Rhizobium meliloti GN=bdhA PE=3 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 8.360e-18
Identity = 76/248 (30.65%), Postives = 119/248 (47.98%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRV-DRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPG-----LFKSEI-----TEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPGT 712
            TG++SG+G      LAKAG  IV       D ++++ DE+   S  +V     ++      + I + + M  + FG  D LVNNAGV    K   D   E+W+ I+  NL+ S+   +     M+     G +INI+S  A      P   AY ++K G+  +TK ++LE+    + VNSICPG     L + +I     T G+ ++  +N V  +  P + F T +  + SL  YL  D +    GT
Sbjct:    8 TGSTSGIGLAIARTLAKAGANIVLNGFGAPDEIRTVTDEVAGLSSGTVLHHPADM---TKPSEIADMMAMVADRFGGADILVNNAGVQFVEKIE-DFPVEQWDRIIAVNLSSSFHTIRGAIPPMKKKGW-GRIINIAS--AHGLVASPFKSAYVAAKHGIMGLTKTVALEVAESGVTVNSICPGYVLTPLVEKQIPDQARTRGITEEQVINEVMLKGQPTKKFITVE-QVASLALYLAGDDAAQITGT 247          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: Y452_LISIN (Uncharacterized oxidoreductase Lin0452 OS=Listeria innocua GN=lin0452 PE=3 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 1.092e-17
Identity = 70/243 (28.81%), Postives = 118/243 (48.56%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLD-LTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVH--KIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPGTFSL 721
            TGASSG+G    + LA+ G ++V AARRV++L+ +   I   SG ++ A   + DV+      +  V++A E +G++DA+  NAG+     SPL  L E+EW  ++  N+ G  L      +    A + G +I  SS+A       PGG  Y ++K  +  + + L +E       IR  +I P    +E+ E +  K+        T   + +G T   + S+V Y +    D+    F++
Sbjct:   11 TGASSGIGEATAILLAEKGAKLVLAARRVEKLEKIVQTIKASSGEAIFA---KTDVTKR-EDNKKLVELAIERYGKVDAIFLNAGI--MPNSPLSALKEDEWEQMIDINIKGV-LNGIAAVLPSFIAQKSGHIIATSSVAGLK--AYPGGAVYGATKWAVRDLMEVLRMESAQEGTNIRTATIYPAAINTELLETITDKE---TEQGMTNLYKQYGVTPDRIASIVAYAIDQPEDINVNEFTV 241          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: FABG5_BRANA (3-oxoacyl-[acyl-carrier-protein] reductase 5, chloroplastic (Fragment) OS=Brassica napus GN=bkr1 PE=2 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 1.092e-17
Identity = 70/238 (29.41%), Postives = 122/238 (51.26%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRI-VAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGL---MKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMY 703
            TGAS G+G+   L L KAGC++ V  AR     + +  +I +  G ++       DVS   A +++ ++ A + +G ID +VNNAG++      + + + +W+ ++  NLTG +L ++    ++    ++G +INI+S+     G + G   YA++KAG+   +K  + E     I VN +CPG   S++T  L   M+K  L      T PL  +G  +  +  LV +L    +  Y
Sbjct:   80 TGASRGIGKAIALSLGKAGCKVLVNYARSAKEAEEVSKQIEEYGGEAITFGG---DVSKE-ADVDSMMKTAVDKWGTIDVVVNNAGITRDTLL-IRMKKSQWDEVIDLNLTGVFLCTQ-AATKIMMKKRKGRIINIASVVGLI-GNI-GQANYAAAKAGVIGFSKTAAREGASRNINVNVVCPGFIASDMTAKLGEDMEKKILG-----TIPLGRYGQPE-YVAGLVEFLALSPASSY 303          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: FABG2_BRANA (3-oxoacyl-[acyl-carrier-protein] reductase 2, chloroplastic OS=Brassica napus GN=bkr2 PE=2 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 1.092e-17
Identity = 72/238 (30.25%), Postives = 122/238 (51.26%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRI-VAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGL---MKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMY 703
            TGAS G+G+   L L KAGC++ V  AR     + +  +I    G   +A+    DVS   A ++  ++ A +A+G ID +VNNAG++      + + + +W+ ++  NLTG +L ++    ++    ++G +INI+S+     G + G   YA++KAG+   +K  + E     I VN +CPG   S++T  L   M+K  L      T PL  +G  +  +  LV +L    +  Y
Sbjct:   91 TGASRGIGKAIALSLGKAGCKVLVNYARSAKEAEQVSKQIEAYGG---QAITFGGDVSKE-ADVDAMMKTAVDAWGTIDVVVNNAGITRDTLL-IRMKKSQWDEVIDLNLTGVFLCTQ-AATKIMMKKRKGRIINIASVVGLI-GNI-GQANYAAAKAGVIGFSKTAAREGASRNINVNVVCPGFIASDMTAKLGEDMEKKILG-----TIPLGRYGQPED-VAGLVEFLALSPAASY 314          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: FABG_SHIFL (3-oxoacyl-[acyl-carrier-protein] reductase OS=Shigella flexneri GN=fabG PE=3 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 1.426e-17
Identity = 61/194 (31.44%), Postives = 106/194 (54.64%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVA-YASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGL 580
            TGAS G+GR     LA  G +++  A   +  +++ D +    G++ + + + +    + A+IE+ ++     FG +D LVNNAG++      + + +EEWN I++TNL+  + +SK V +R     + G +I I S+  T      GG A YA++KAGL   +K L+ E+    I VN + PG  ++++T  L
Sbjct:   11 TGASRGIGRAIAETLAARGAKVIGTATSENGAQAISDYL----GANGKGLMLNV---TDPASIESVLEKIRAEFGEVDILVNNAGITRD-NLLMRMKDEEWNDIIETNLSSVFRLSKAV-MRAMMKKRHGRIITIGSVVGTMGN---GGQANYAAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDMTRAL 192          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: FABG_ECOLI (3-oxoacyl-[acyl-carrier-protein] reductase OS=Escherichia coli (strain K12) GN=fabG PE=1 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 1.426e-17
Identity = 61/194 (31.44%), Postives = 106/194 (54.64%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVA-YASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGL 580
            TGAS G+GR     LA  G +++  A   +  +++ D +    G++ + + + +    + A+IE+ ++     FG +D LVNNAG++      + + +EEWN I++TNL+  + +SK V +R     + G +I I S+  T      GG A YA++KAGL   +K L+ E+    I VN + PG  ++++T  L
Sbjct:   11 TGASRGIGRAIAETLAARGAKVIGTATSENGAQAISDYL----GANGKGLMLNV---TDPASIESVLEKIRAEFGEVDILVNNAGITRD-NLLMRMKDEEWNDIIETNLSSVFRLSKAV-MRAMMKKRHGRIITIGSVVGTMGN---GGQANYAAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDMTRAL 192          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: FABG_ARATH (3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic OS=Arabidopsis thaliana GN=At1g24360 PE=2 SV=2)

HSP 1 Score: 90.5077 bits (223), Expect = 1.426e-17
Identity = 70/238 (29.41%), Postives = 121/238 (50.84%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRI-VAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGL---MKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMY 703
            TGAS G+G+   L L KAGC++ V  AR     + +  +I +  G   +A+    DVS     ++  ++ A + +G ID +VNNAG++      + + + +W+ ++  NLTG +L ++   +++    + G +INISS+     G + G   YA++K G+ + +K  + E     I VN +CPG   S++T  L   M+K  L      T PL  +G  +  +  LV +L    +  Y
Sbjct:   82 TGASRGIGKAIALALGKAGCKVLVNYARSAKEAEEVAKQIEEYGG---QAITFGGDVS-KATDVDAMMKTALDKWGTIDVVVNNAGITRDTLL-IRMKQSQWDEVIALNLTGVFLCTQ-AAVKIMMKKKRGRIINISSVVGLI-GNI-GQANYAAAKGGVISFSKTAAREGASRNINVNVVCPGFIASDMTAELGEDMEKKILG-----TIPLGRYGKAE-EVAGLVEFLALSPAASY 305          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: DHGA_BACME (Glucose 1-dehydrogenase A OS=Bacillus megaterium GN=gdhA PE=3 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 1.862e-17
Identity = 63/189 (33.33%), Postives = 101/189 (53.44%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEI 568
            TG S+GLGR   +   +   ++V      +  +   D   +   +  +A+ V+ DV+     + N VQ A + FG +D ++NNAGV   V S  +L+ + WN ++ TNLTG++L S+       + + +G+VIN+SS+        P  V YA+SK G+  MT+ L+LE     IRVN+I PG   + I
Sbjct:   13 TGGSTGLGRAMAVRFGQEEAKVVI--NYYNNEEEALDAKKEVEEAGGQAIIVQGDVTKEEDVV-NLVQTAIKEFGTLDVMINNAGVENPVPSH-ELSLDNWNKVIDTNLTGAFLGSREAIKYFVENDIKGNVINMSSVHEMI--PWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAMNTPI 195          
The following BLAST results are available for this feature:
BLAST of EY659229 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 262
Match NameE-valueIdentityDescription
FABG_RICFE8.360e-1828.813-oxoacyl-[acyl-carrier-protein] reductase OS=Rick... [more]
DHG2_BACME8.360e-1834.74Glucose 1-dehydrogenase 2 OS=Bacillus megaterium G... [more]
BDHA_RHIME8.360e-1830.65D-beta-hydroxybutyrate dehydrogenase OS=Rhizobium ... [more]
Y452_LISIN1.092e-1728.81Uncharacterized oxidoreductase Lin0452 OS=Listeria... [more]
FABG5_BRANA1.092e-1729.413-oxoacyl-[acyl-carrier-protein] reductase 5, chlo... [more]
FABG2_BRANA1.092e-1730.253-oxoacyl-[acyl-carrier-protein] reductase 2, chlo... [more]
FABG_SHIFL1.426e-1731.443-oxoacyl-[acyl-carrier-protein] reductase OS=Shig... [more]
FABG_ECOLI1.426e-1731.443-oxoacyl-[acyl-carrier-protein] reductase OS=Esch... [more]
FABG_ARATH1.426e-1729.413-oxoacyl-[acyl-carrier-protein] reductase, chloro... [more]
DHGA_BACME1.862e-1733.33Glucose 1-dehydrogenase A OS=Bacillus megaterium G... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-G11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659229 ID=EY659229|Name=EY659229|organism=Citrus sinensis|type=EST|length=909bp
GACCGGGGCATCCTCCGGTTTAGGCCGAGAATTCTGTCTCGACTTGGCCA
AAGCTGGCTGCCGGATTGTCGCAGCGGCTCGCCGCGTCGACCGGCTCAAG
TCTCTCTGCGACGAGATCAATAAGCAGTCCGGGAGTAGTGTTAGAGCCAT
GGCCGTTGAGCTAGACGTCAGTGCCAATGGAGCCGCTATTGAGAATTCCG
TACAGATGGCTTGGGAAGCCTTCGGCCGAATCGATGCTTTGGTTAATAAT
GCCGGTGTATCAGGTGCTGTGAAGAGTCCATTAGATTTGACGGAGGAGGA
GTGGAATCATATTATGAAAACGAATTTGACAGGGTCTTGGTTGGTTTCGA
AATATGTATGCATCCGCATGCGTGACGCAAATCAGGAAGGATCAGTAATT
AATATATCTTCCATTGCTGCTACTAGCCGTGGACAGCTACCCGGAGGTGT
TGCATATGCTTCTTCAAAAGCAGGCCTAAATGCCATGACAAAGTGTCTGT
CATTGGAACTTGGGGTGCACAAAATCAGAGTCAATTCGATATGCCCTGGA
CTTTTCAAATCTGAAATCACCGAGGGGCTTATGAAAAAAGACTGGCTGAA
TAATGTGGCCTCAAGAACTTACCCTTTAAGAGATTTCGGCACCACCGACC
CCGCACTGACATCGCTTGTTCGGTACCTGGTTCATGACTCTTCTGATATG
TATCCGGGCACATTTTCATTGTTGATTCTGGGGCTACGCTACCANGTCTC
CCTATTTTCTCTTCCCCTTGACTTGTTCGGGAACTTTACAGTCAAATCTC
TTCTATTCTTTAAATCCTTGCTGCAATATATTCTAACACANGAGCATAAA
TGGGCCTGTGCTATTGGGGAAGTACTGCGGTATACTCATTAAAAAAAAAA
AAAAAGAGG
back to top