EY659229

Overview
NameEY659229
Unique NameEY659229
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length909
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: DHG4_BACME (Glucose 1-dehydrogenase 4 OS=Bacillus megaterium GN=gdhIV PE=3 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 1.862e-17
Identity = 63/189 (33.33%), Postives = 101/189 (53.44%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEI 568
            TG S+GLGR   +   +   ++V      +  +   D   +   +  +A+ V+ DV+     + N VQ A + FG +D ++NNAGV   V S  +L+ + WN ++ TNLTG++L S+       + + +G+VIN+SS+        P  V YA+SK G+  MT+ L+LE     IRVN+I PG   + I
Sbjct:   13 TGGSTGLGRAMAVRFGQEEAKVVI--NYYNNEEEALDAKKEVEEAGGQAIIVQGDVTKEEDVV-NLVQTAIKEFGTLDVMINNAGVENPVPSH-ELSLDNWNKVIDTNLTGAFLGSREAIKYFVENDIKGNVINMSSVHEMI--PWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAMNTPI 195          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: DHG3_BACME (Glucose 1-dehydrogenase 3 OS=Bacillus megaterium GN=gdhIII PE=3 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 1.862e-17
Identity = 63/189 (33.33%), Postives = 101/189 (53.44%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEI 568
            TG S+GLGR   +   +   ++V      +  +   D   +   +  +A+ V+ DV+     + N VQ A + FG +D ++NNAGV   V S  +L+ + WN ++ TNLTG++L S+       + + +G+VIN+SS+        P  V YA+SK G+  MT+ L+LE     IRVN+I PG   + I
Sbjct:   13 TGGSTGLGRAMAVRFGQEEAKVVI--NYYNNEEEALDAKKEVEEAGGQAIIVQGDVTKEEDVV-NLVQTAIKEFGTLDVMINNAGVENPVPSH-ELSLDNWNKVIDTNLTGAFLGSREAIKYFVENDIKGNVINMSSVHEMI--PWPLFVHYAASKGGMKQMTETLALEYAPKGIRVNNIGPGAMNTPI 195          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: SDR1_PICAB (Short-chain type dehydrogenase/reductase OS=Picea abies PE=2 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 2.432e-17
Identity = 63/188 (33.51%), Postives = 98/188 (52.13%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIV----AAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLT-EEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPG 550
            TGAS G+GRE  L++A+ G ++V    +     + + S+ +  +  SG  VRA+  + DV A  + +      A  AFG +  +VNNAGV+ +    L  T +EEW+ I + N  G++L S+    R+      G +INISS        +P   AY +SKA +  MT+ L+ EL   +I  N + PG
Sbjct:   27 TGASRGIGREIALNMAEKGAKVVIHYSSNQHAAEEVASIINNKSPSSGDGVRAIVCKADV-AEPSQVAQLFDTAEHAFGPLHIVVNNAGVTDSKYPTLAQTSDEEWDRIFQVNCKGAFLCSREAAKRVVRGG-GGRIINISSSLVAM--PIPRYGAYTASKAAVEMMTRILAQELRGTQITANCVAPG 210          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: PECR_RAT (Peroxisomal trans-2-enoyl-CoA reductase OS=Rattus norvegicus GN=Pecr PE=2 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 2.432e-17
Identity = 59/192 (30.73%), Postives = 106/192 (55.21%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEI--NKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPL-DLTEEEWNHIMKTNLTGSWLVSKYVCIR-MRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSE 565
            TG ++G+G+    +L   GC +V A+R++DRL +  DE+  ++   SS +  A++ ++      + N V+     +G+I+ LVNNAG  G   +P  D+T + W  +++TNLTG++ + K V    M+D    GS++NI  I   + G  P      +++AG+  +TK ++L      +R+N + PG   S+
Sbjct:   24 TGGATGIGKAISRELLHLGCNVVIASRKLDRLTAAVDELRASQPPSSSTQVTAIQCNIRKE-EEVNNLVKSTLAKYGKINFLVNNAG--GQFMAPAEDITAKGWQAVIETNLTGTFYMCKAVYNSWMKD--HGGSIVNI--IVLLNNG-FPTAAHSGAARAGVYNLTKTMALTWASSGVRINCVAPGTIYSQ 207          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: FABG_BUCAP (3-oxoacyl-[acyl-carrier-protein] reductase OS=Buchnera aphidicola subsp. Schizaphis graminum GN=fabG PE=3 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 2.432e-17
Identity = 60/225 (26.67%), Postives = 118/225 (52.44%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAAT--SRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLV 670
            TGA+ GLG+E  + L++ G +++  +  VD +K++   + K     +      LD+    + +E   ++  + +  ID L+NNAG++      + ++ +EW +++K NLT  + +SK V IR     + G ++ I S+     +RGQ    + Y++SK+GL    K L+LE+    I VN + PG  K+ +T+ L    +  +++    P++  GT +    +++
Sbjct:   11 TGANQGLGKEIAIKLSQKGIQVIGTSTTVDGVKTINKYLKKNGFGFI------LDLKDTDSILEKMKEICQKKYS-IDILINNAGITSD-NLLVYMSNKEWENVIKINLTSVFYMSKSV-IRSMIKKRYGRIVTIGSVIGYLGNRGQ----INYSASKSGLIGFHKSLALEVAQKGITVNIVSPGFIKTNLTKNLNVFQYKKHLSK--IPMKRIGTAEEIANAVI 220          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: IDNO_ECOLI (Gluconate 5-dehydrogenase OS=Escherichia coli (strain K12) GN=idnO PE=3 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 3.177e-17
Identity = 68/238 (28.57%), Postives = 123/238 (51.68%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPL-DLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAAT-SRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPG 709
            TG++ G+G      L K G +I+      +R +   ++++++    ++A+A   +V+ +   I+ +V+   +  G ID LVNNAG+    + P  +  E+EWN ++  N T  +LVS+ V   M +  + G VINI S+ +   R  +     YA+SK  +  +T+ + +EL  H I+VN I PG FK+E+T+ L++ +       +  P   +G     + + V +L   +SD   G
Sbjct:   15 TGSAQGIGFLLATGLGKYGAQIIINDITAERAELAVEKLHQEG---IQAVAAPFNVT-HKHEIDAAVEHIEKDIGPIDVLVNNAGIQR--RHPFTEFPEQEWNDVIAVNQTAVFLVSQAVTRHMVE-RKAGKVINICSMQSELGRDTI---TPYAASKGAVKMLTRGMCVELARHNIQVNGIAPGYFKTEMTKALVEDEAFTAWLCKRTPAARWGDPQELIGAAV-FLSSKASDFVNG 241          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: IDNO_ECOL6 (Gluconate 5-dehydrogenase OS=Escherichia coli O6 GN=idnO PE=3 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 3.177e-17
Identity = 68/238 (28.57%), Postives = 123/238 (51.68%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPL-DLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAAT-SRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPG 709
            TG++ G+G      L K G +I+      +R +   ++++++    ++A+A   +V+ +   I+ +V+   +  G ID LVNNAG+    + P  +  E+EWN ++  N T  +LVS+ V   M +  + G VINI S+ +   R  +     YA+SK  +  +T+ + +EL  H I+VN I PG FK+E+T+ L++ +       +  P   +G     + + V +L   +SD   G
Sbjct:   15 TGSAQGIGFLLATGLGKYGAQIIINDITAERAELAVEKLHQEG---IQAVAAPFNVT-HKHEIDAAVEHIEKDIGPIDVLVNNAGIQR--RHPFTEFPEQEWNDVIAVNQTAVFLVSQAVTRHMVE-RKAGKVINICSMQSELGRDTI---TPYAASKGAVKMLTRGMCVELARHNIQVNGIAPGYFKTEMTKALVEDEAFTAWLCKRTPAARWGDPQELIGAAV-FLSSKASDFVNG 241          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: Y4MP_RHISN (Uncharacterized short-chain type dehydrogenase/reductase y4mP OS=Rhizobium sp. (strain NGR234) GN=NGR_a02430 PE=3 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 4.149e-17
Identity = 61/193 (31.61%), Postives = 105/193 (54.40%), Query Frame = 2
Query:    2 TGASS--GLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINK-QSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEIT 571
            +GA+S  G+GR      A  G R+       D  K+   ++   + G+ +    +  DV A+ A+  ++      AFG  + L+NNAG++  VK+ LD+++ +W  I+  N+TG   +S+     MR  N  GS+  +SS++A   G + GG  Y+++KAG+  + K ++ E G   IRVN + PGL +++IT
Sbjct:   11 SGAASKRGIGRATAELFASHGARVAILDINADEAKAAAGDLPPVEHGAHI---GLRCDV-ADRASCTSASDEVLSAFGVANILINNAGITQPVKT-LDISDADWQRIVAVNMTGVLNLSQVFIPNMRQ-NGGGSIACMSSVSAQRGGGIFGGPHYSAAKAGVLGLAKAMAREFGPDSIRVNCVTPGLIQTDIT 197          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: FABG_BUCBP (3-oxoacyl-[acyl-carrier-protein] reductase OS=Buchnera aphidicola subsp. Baizongia pistaciae GN=fabG PE=3 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 4.149e-17
Identity = 67/236 (28.39%), Postives = 120/236 (50.85%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPG 709
            TGA+ GLG+    +L+      V       +   + ++  K +G     + ++LD++ N   I  ++   ++ FGR+D L+NNAG+    K  +++  ++WN ++  NL   + +SK V IR    N++G +I I S+ A       G   Y+++K GL    K L+LEL    I VN I PGL K+ +T  L +K  L+   S+  P++  GT    ++ +  +L+ + ++   G
Sbjct:   11 TGANRGLGKGIAEELSNTNNITVIGTSTSQKGCKIINKYLKNNG-----IGIKLDIT-NPNEITKTMDFVYKNFGRVDILINNAGIIRD-KLLINMKTQDWNSVLNVNLNSIFYMSKSV-IRNMIKNKQGKIITIGSVIAHIGNC--GQTNYSAAKLGLVGFHKSLALELAPKGITVNMIAPGLIKTGMTNNLSQKQ-LSKYLSK-IPMKRLGTI-KEISKITLFLISNDANYITG 233          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: DHK1_STRVN (Granaticin polyketide synthase putative ketoacyl reductase 1 OS=Streptomyces violaceoruber GN=gra-orf5 PE=3 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 4.149e-17
Identity = 74/242 (30.58%), Postives = 120/242 (49.59%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVC-IRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITE----------GLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSS 694
            TGA+SG+G      LA  G R    AR  +RL     E+  + G  V     ++   A+ A I   V  A + +G +D LVNNAG SG   +  ++ +E W  ++ TNLT  +L++K V       A + G +INI+S     +  +   V Y++SK G+  +TK L LEL    I VN++CPG  ++ + E           + +++  + + +R  PL  +  T   + ++V YLV D +
Sbjct:   23 TGATSGIGLAIARRLAALGARTFLCARDEERLAQTVKELRGE-GFDVDGTVCDV---ADPAQIRAYVAAAVQRYGTVDILVNNAGRSGG-GATAEIADELWLDVITTNLTSVFLMTKEVLNAGGMLAKKRGRIINIASTGG--KQGVVHAVPYSASKHGVVGLTKALGLELARTGITVNAVCPGFVETPMAERVREHYAGIWQVSEEETFDRITNRV-PLGRYVET-REVAAMVEYLVADDA 255          
The following BLAST results are available for this feature:
BLAST of EY659229 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 262
Match NameE-valueIdentityDescription
DHG4_BACME1.862e-1733.33Glucose 1-dehydrogenase 4 OS=Bacillus megaterium G... [more]
DHG3_BACME1.862e-1733.33Glucose 1-dehydrogenase 3 OS=Bacillus megaterium G... [more]
SDR1_PICAB2.432e-1733.51Short-chain type dehydrogenase/reductase OS=Picea ... [more]
PECR_RAT2.432e-1730.73Peroxisomal trans-2-enoyl-CoA reductase OS=Rattus ... [more]
FABG_BUCAP2.432e-1726.673-oxoacyl-[acyl-carrier-protein] reductase OS=Buch... [more]
IDNO_ECOLI3.177e-1728.57Gluconate 5-dehydrogenase OS=Escherichia coli (str... [more]
IDNO_ECOL63.177e-1728.57Gluconate 5-dehydrogenase OS=Escherichia coli O6 G... [more]
Y4MP_RHISN4.149e-1731.61Uncharacterized short-chain type dehydrogenase/red... [more]
FABG_BUCBP4.149e-1728.393-oxoacyl-[acyl-carrier-protein] reductase OS=Buch... [more]
DHK1_STRVN4.149e-1730.58Granaticin polyketide synthase putative ketoacyl r... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-G11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659229 ID=EY659229|Name=EY659229|organism=Citrus sinensis|type=EST|length=909bp
GACCGGGGCATCCTCCGGTTTAGGCCGAGAATTCTGTCTCGACTTGGCCA
AAGCTGGCTGCCGGATTGTCGCAGCGGCTCGCCGCGTCGACCGGCTCAAG
TCTCTCTGCGACGAGATCAATAAGCAGTCCGGGAGTAGTGTTAGAGCCAT
GGCCGTTGAGCTAGACGTCAGTGCCAATGGAGCCGCTATTGAGAATTCCG
TACAGATGGCTTGGGAAGCCTTCGGCCGAATCGATGCTTTGGTTAATAAT
GCCGGTGTATCAGGTGCTGTGAAGAGTCCATTAGATTTGACGGAGGAGGA
GTGGAATCATATTATGAAAACGAATTTGACAGGGTCTTGGTTGGTTTCGA
AATATGTATGCATCCGCATGCGTGACGCAAATCAGGAAGGATCAGTAATT
AATATATCTTCCATTGCTGCTACTAGCCGTGGACAGCTACCCGGAGGTGT
TGCATATGCTTCTTCAAAAGCAGGCCTAAATGCCATGACAAAGTGTCTGT
CATTGGAACTTGGGGTGCACAAAATCAGAGTCAATTCGATATGCCCTGGA
CTTTTCAAATCTGAAATCACCGAGGGGCTTATGAAAAAAGACTGGCTGAA
TAATGTGGCCTCAAGAACTTACCCTTTAAGAGATTTCGGCACCACCGACC
CCGCACTGACATCGCTTGTTCGGTACCTGGTTCATGACTCTTCTGATATG
TATCCGGGCACATTTTCATTGTTGATTCTGGGGCTACGCTACCANGTCTC
CCTATTTTCTCTTCCCCTTGACTTGTTCGGGAACTTTACAGTCAAATCTC
TTCTATTCTTTAAATCCTTGCTGCAATATATTCTAACACANGAGCATAAA
TGGGCCTGTGCTATTGGGGAAGTACTGCGGTATACTCATTAAAAAAAAAA
AAAAAGAGG
back to top