EY659229

Overview
NameEY659229
Unique NameEY659229
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length909
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: DHG_BACSU (Glucose 1-dehydrogenase OS=Bacillus subtilis GN=gdh PE=2 SV=2)

HSP 1 Score: 88.9669 bits (219), Expect = 4.149e-17
Identity = 64/191 (33.51%), Postives = 106/191 (55.50%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAA--ARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEI 568
            TGA+SGLG+   +   K   ++V    + + D    + +E+ K  G +V    V+ DV+     ++N VQ A + FG +D ++NNAG+   V S  ++  ++W+ ++ TNLTG++L S+       + + +G+VIN+SS+        P  V YA+SK G+  MT+ L+LE     IRVN+I PG   + I
Sbjct:   13 TGAASGLGKAMAIRFGKEQAKVVINYYSNKQDP-NEVKEEVIKAGGEAV---VVQGDVTKE-EDVKNIVQTAIKEFGTLDIMINNAGLENPVPSH-EMPLKDWDKVIGTNLTGAFLGSREAIKYFVENDIKGNVINMSSVHEVI--PWPLFVHYAASKGGIKLMTETLALEYAPKGIRVNNIGPGAINTPI 195          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: DHB8_RAT (Estradiol 17-beta-dehydrogenase 8 OS=Rattus norvegicus GN=Hsd17b8 PE=2 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 5.419e-17
Identity = 69/240 (28.75%), Postives = 118/240 (49.17%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAA----ARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPG 709
            TGA SG+GR   + LA  G  + A     A   D ++ L +  ++      +  A + DVS  G A +  ++     F R  ++V +       +  L ++EE+W+ ++  NL G++LV++     +  +   GS+INISSI     G + G   YASSKAG+  +T+  + ELG H IR NS+ PG   + +T+ + +K  + +  +   PL   G  +  +  +V +L  + S    G
Sbjct:   15 TGAGSGIGRAISVRLAAEGAAVAACDLDGAAAQDTVRLLGNPGSEDREPRGKHAAFQADVS-EGPAAKRLLEQVQACFFRPPSVVVSCAGITRDEFLLHMSEEDWDRVIAVNLKGTFLVTQAAAQALVSSGGRGSIINISSIVGKV-GNI-GQTNYASSKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKMPEK--VKDKVTAMIPLGHMGDPED-VADVVAFLASEDSGYITG 248          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: FABG_AGGAC (3-oxoacyl-[acyl-carrier-protein] reductase OS=Aggregatibacter actinomycetemcomitans GN=fabG PE=3 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 7.077e-17
Identity = 62/194 (31.96%), Postives = 106/194 (54.64%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAAR-RVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAAT--SRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITE 574
            TG+S G+G+   L LA+AG  IV   R R++  +++   + ++ G + R +  + DVS    A +       EA G    +V NAG++     P  LT+E+W+ +++TNL G + V   + + M    + G ++ I+S++    +RGQ    V Y++SKAG+    K L++EL   KI VN + PGL  ++I +
Sbjct:    8 TGSSRGIGKAIALRLAQAGFDIVVHCRSRIEEAEAVAQAV-RELGQNARVL--QFDVSCRSEAADKLTADV-EAHGAYYGVVLNAGLTRDNAFPA-LTDEDWDRVLRTNLDGFYNVLHPIMMPMIRRRKAGRIVCITSVSGLIGNRGQ----VNYSASKAGIIGAAKALAVELAKRKITVNCVAPGLIDTDILD 192          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: PHAB_ACISR (Acetoacetyl-CoA reductase OS=Acinetobacter sp. (strain RA3849) GN=phaB PE=3 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 9.243e-17
Identity = 75/232 (32.33%), Postives = 120/232 (51.72%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAA--RRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPA-LTSLVRYLVHD 688
            TGA  G+G E C  L  AG +I+A    R  DR K        Q  S VR +  +L+   N  A   ++Q A  A GR+D LVNNAG++        ++ E+W+ ++ TNL   + V++ V  +M +  + G ++NISS+    +GQ  G   Y++SKAG+   TK L+ E     I VN + PG   + +    M++D + ++ ++  PL+      PA + + V YLV +
Sbjct:   10 TGALGGIGSEICRQLVTAGYKIIATVVPREEDREKQWLQSEGFQD-SDVRFVLTDLN---NHEAATAAIQEAIAAEGRVDVLVNNAGITRDATFK-KMSYEQWSQVIDTNLKTLFTVTQPVFNKMLE-QKSGRIVNISSVNGL-KGQF-GQANYSASKAGIIGFTKALAQEGARSNICVNVVAPGYTATPMVTA-MREDVIKSIEAQ-IPLQRLAA--PAEIAAAVMYLVSE 229          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: FABG_CHLPN (3-oxoacyl-[acyl-carrier-protein] reductase OS=Chlamydia pneumoniae GN=fabG PE=3 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 9.243e-17
Identity = 66/219 (30.14%), Postives = 110/219 (50.23%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGL---MKKDWLNNVASRTYPLRDFGTTD 649
            TG S G+G        + G  +       +R +++ + +    G    A    +DVS NG  +++ VQ   +   +ID LVNNAG++      + ++E++W  ++ TNLT  +     V   M  A + GS+IN++SI A       G   YA++KAG+ A TK L+ E+    IRVN + PG  ++++T  L   +K +WL ++     PL   GT +
Sbjct:   13 TGGSRGIGLGIVKLFLENGADVEIWGLNEERGQAVIESLTGLGGEVSFA---RVDVSHNGG-VKDCVQKFLDKHNKIDILVNNAGITRD-NLLMRMSEDDWQSVISTNLTSLYYTCSSVIRHMIKA-RSGSIINVASIVAKIGSA--GQTNYAAAKAGIIAFTKSLAKEVAARNIRVNCLAPGFIETDMTSVLNDNLKAEWLKSI-----PLGRAGTPE 218          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: PECR_PONAB (Peroxisomal trans-2-enoyl-CoA reductase OS=Pongo abelii GN=PECR PE=2 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 1.207e-16
Identity = 57/190 (30.00%), Postives = 104/190 (54.74%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVS-ANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLD-LTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSE 565
            TG ++G+G+    +L + G  +V A+R+++RLKS   E+      + +A  + +  +  N   + N V+   + FG+I+ LVNN G  G   S  + ++ + W+ +++TNLTG++ + K V          GS++NI  I +   G LP  V   +++AG+  +TK L+LE     +R+N + PG+  S+
Sbjct:   24 TGGATGIGKAIVKELLELGSNVVIASRKLERLKSAAGELQANLPPTKQARVIPIQCNIRNEEEVNNLVKSTLDIFGKINFLVNNGG--GQFLSLAEHISSKGWHAVLETNLTGTFYMCKAVYSSWM-KEHGGSIVNI--IVSIKTG-LPLAVHSGAARAGVYNLTKSLALEWACSGVRINCVAPGVIYSQ 207          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: FABG_SALTY (3-oxoacyl-[acyl-carrier-protein] reductase OS=Salmonella typhimurium GN=fabG PE=3 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 1.207e-16
Identity = 58/193 (30.05%), Postives = 103/193 (53.37%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGL 580
            TGAS G+GR     L   G +++  A   +  K++ D +    G++ + + + +    + A+IE+ ++     FG +D LVNNAG++      + + ++EWN I++TNL+  + +SK V +R     + G +I I S+  T      G   YA++KAGL   +K L+ E+    I VN + PG  ++++T  L
Sbjct:   11 TGASRGIGRAIAETLVARGAKVIGTATSENGAKNISDYL----GANGKGLMLNV---TDPASIESVLENIRAEFGEVDILVNNAGITRD-NLLMRMKDDEWNDIIETNLSSVFRLSKAV-MRAMMKKRCGRIITIGSVVGTMGNA--GQANYAAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDMTRAL 192          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: FABG_SALTI (3-oxoacyl-[acyl-carrier-protein] reductase OS=Salmonella typhi GN=fabG PE=3 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 1.207e-16
Identity = 58/193 (30.05%), Postives = 103/193 (53.37%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGL 580
            TGAS G+GR     L   G +++  A   +  K++ D +    G++ + + + +    + A+IE+ ++     FG +D LVNNAG++      + + ++EWN I++TNL+  + +SK V +R     + G +I I S+  T      G   YA++KAGL   +K L+ E+    I VN + PG  ++++T  L
Sbjct:   11 TGASRGIGRAIAETLVARGAKVIGTATSENGAKNISDYL----GANGKGLMLNV---TDPASIESVLENIRAEFGEVDILVNNAGITRD-NLLMRMKDDEWNDIIETNLSSVFRLSKAV-MRAMMKKRCGRIITIGSVVGTMGNA--GQANYAAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDMTRAL 192          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: DCXR_MESAU (L-xylulose reductase OS=Mesocricetus auratus GN=DCXR PE=1 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 1.207e-16
Identity = 70/231 (30.30%), Postives = 109/231 (47.19%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSS 694
            TGA  G+GR   L L  AG  +VA +R    L SL  E        V  + V+L       A   + + A  + G +D LVNNA V+  ++  L++T+E ++     NL     VS+ V   M      G+++N+SS A  S+  L     Y S+K  L+ +TK ++LELG HKIRVN++ P +  + +            V     PL  F   +  + +++  L H S+
Sbjct:   13 TGAGKGIGRSTVLALQAAGAHVVAVSRTQADLDSLVSEC-----PGVETVCVDL-------ADWEATEQALSSVGPVDLLVNNAAVA-LLQPFLEVTKEAFDMSFNVNLRAVIQVSQIVARGMIARGAPGAIVNVSSQA--SQRALANHSVYCSTKGALDMLTKMMALELGPHKIRVNAVNPTVVMTSMGRTNWSDPHKAKVMLDRIPLGKFAEVENVVDAILFLLSHRSN 228          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: CPNA_COMTE (Cyclopentanol dehydrogenase OS=Comamonas testosteroni GN=cpnA PE=3 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 1.207e-16
Identity = 61/194 (31.44%), Postives = 99/194 (51.03%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLM 583
            TG + G+G   C  LA+ G  +  +    +       EI +Q G   +A  + LDV+ N      +V        R+DALVNNAG+   +K   D + EEW+ I + N+   +L ++ V   MR A++ G ++N+SSI        PG  AY +SK  +   TK  +++L    IRVNS+ PG+  + +T+ ++
Sbjct:   12 TGGAMGMGLTHCTLLAREGATVYLSDMNEELGHQAVAEIRRQGG---KAHFLHLDVT-NENHWTGAVDTILAESDRLDALVNNAGIL-TLKPVQDTSNEEWDRIFEINVRSVFLGTRAVIEPMRKAHK-GCIVNVSSIYGLVGA--PGAAAYEASKGAVRLFTKACAVDLAPFNIRVNSVHPGVIATPMTQQIL 197          
The following BLAST results are available for this feature:
BLAST of EY659229 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 262
Match NameE-valueIdentityDescription
DHG_BACSU4.149e-1733.51Glucose 1-dehydrogenase OS=Bacillus subtilis GN=gd... [more]
DHB8_RAT5.419e-1728.75Estradiol 17-beta-dehydrogenase 8 OS=Rattus norveg... [more]
FABG_AGGAC7.077e-1731.963-oxoacyl-[acyl-carrier-protein] reductase OS=Aggr... [more]
PHAB_ACISR9.243e-1732.33Acetoacetyl-CoA reductase OS=Acinetobacter sp. (st... [more]
FABG_CHLPN9.243e-1730.143-oxoacyl-[acyl-carrier-protein] reductase OS=Chla... [more]
PECR_PONAB1.207e-1630.00Peroxisomal trans-2-enoyl-CoA reductase OS=Pongo a... [more]
FABG_SALTY1.207e-1630.053-oxoacyl-[acyl-carrier-protein] reductase OS=Salm... [more]
FABG_SALTI1.207e-1630.053-oxoacyl-[acyl-carrier-protein] reductase OS=Salm... [more]
DCXR_MESAU1.207e-1630.30L-xylulose reductase OS=Mesocricetus auratus GN=DC... [more]
CPNA_COMTE1.207e-1631.44Cyclopentanol dehydrogenase OS=Comamonas testoster... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-G11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659229 ID=EY659229|Name=EY659229|organism=Citrus sinensis|type=EST|length=909bp
GACCGGGGCATCCTCCGGTTTAGGCCGAGAATTCTGTCTCGACTTGGCCA
AAGCTGGCTGCCGGATTGTCGCAGCGGCTCGCCGCGTCGACCGGCTCAAG
TCTCTCTGCGACGAGATCAATAAGCAGTCCGGGAGTAGTGTTAGAGCCAT
GGCCGTTGAGCTAGACGTCAGTGCCAATGGAGCCGCTATTGAGAATTCCG
TACAGATGGCTTGGGAAGCCTTCGGCCGAATCGATGCTTTGGTTAATAAT
GCCGGTGTATCAGGTGCTGTGAAGAGTCCATTAGATTTGACGGAGGAGGA
GTGGAATCATATTATGAAAACGAATTTGACAGGGTCTTGGTTGGTTTCGA
AATATGTATGCATCCGCATGCGTGACGCAAATCAGGAAGGATCAGTAATT
AATATATCTTCCATTGCTGCTACTAGCCGTGGACAGCTACCCGGAGGTGT
TGCATATGCTTCTTCAAAAGCAGGCCTAAATGCCATGACAAAGTGTCTGT
CATTGGAACTTGGGGTGCACAAAATCAGAGTCAATTCGATATGCCCTGGA
CTTTTCAAATCTGAAATCACCGAGGGGCTTATGAAAAAAGACTGGCTGAA
TAATGTGGCCTCAAGAACTTACCCTTTAAGAGATTTCGGCACCACCGACC
CCGCACTGACATCGCTTGTTCGGTACCTGGTTCATGACTCTTCTGATATG
TATCCGGGCACATTTTCATTGTTGATTCTGGGGCTACGCTACCANGTCTC
CCTATTTTCTCTTCCCCTTGACTTGTTCGGGAACTTTACAGTCAAATCTC
TTCTATTCTTTAAATCCTTGCTGCAATATATTCTAACACANGAGCATAAA
TGGGCCTGTGCTATTGGGGAAGTACTGCGGTATACTCATTAAAAAAAAAA
AAAAAGAGG
back to top