EY659229

Overview
NameEY659229
Unique NameEY659229
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length909
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: CPNA_COMS9 (Cyclopentanol dehydrogenase OS=Comamonas sp. (strain NCIMB 9872) GN=cpnA PE=1 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 1.207e-16
Identity = 61/194 (31.44%), Postives = 99/194 (51.03%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLM 583
            TG + G+G   C  LA+ G  +  +    +       EI +Q G   +A  + LDV+ N      +V        R+DALVNNAG+   +K   D + EEW+ I + N+   +L ++ V   MR A++ G ++N+SSI        PG  AY +SK  +   TK  +++L    IRVNS+ PG+  + +T+ ++
Sbjct:   12 TGGAMGMGLTHCTLLAREGATVYLSDMNEELGHQAVAEIRRQGG---KAHFLHLDVT-NENHWTGAVDTILAESDRLDALVNNAGIL-TLKPVQDTSNEEWDRIFEINVRSVFLGTRAVIEPMRKAHK-GCIVNVSSIYGLVGA--PGAAAYEASKGAVRLFTKACAVDLAPFNIRVNSVHPGVIATPMTQQIL 197          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: Y1627_STAS1 (Uncharacterized oxidoreductase SSP1627 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP1627 PE=3 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 1.577e-16
Identity = 62/205 (30.24%), Postives = 104/205 (50.73%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLT-EEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGV--HKIRVNSICPGLFKSEITEGLMKKDWLNNV 607
            TGASSG+G E    L++ G ++V  ARR+DRL+ +  ++   S S  +    + D       +   ++ A+  FGRID L+NNAG+    +S L+   ++EWN ++  N+ G       V   MR   + G +IN++S+A       PG   Y  +K  + A+T+ L  E  +    IR   + PG   +E+T+ +  KD   ++
Sbjct:   12 TGASSGIGEETVNLLSENGAKLVLGARRLDRLEKIQQKVGHDSVSIKKTDVTKPD------EVNALIETAYNDFGRIDVLINNAGL--MPQSFLEKNKQDEWNQMIDVNIKGVLYGIGAVLPYMR-KQKSGHIINLASVA--GHVVFPGSAVYCGTKYAVRAITEGLRQEEAIVGSNIRTTILSPGAVSTELTDHISDKDMKQDI 205          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: DHB8_MOUSE (Estradiol 17-beta-dehydrogenase 8 OS=Mus musculus GN=Hsd17b8 PE=1 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 1.577e-16
Identity = 68/239 (28.45%), Postives = 115/239 (48.12%), Query Frame = 2
Query:    5 GASSGLGREFCLDLAKAGCRIVAA----ARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPG 709
            GA SG+GR   + LA  G  + A     A   D ++ L    ++      +  A + DVS  G A    ++     F R  ++V +       +  L ++EE+W+ ++  NL G++LV++     +  +   GS+INISSI     G + G   YASSKAG+  +T+  + ELG H IR NS+ PG   + +T+ + +K  + +  +   PL   G  +  +  +V +L  + S    G
Sbjct:   17 GAGSGIGRAISVRLAAEGAAVAACDLDGAAAQDTVRLLGSPGSEDGAPRGKHAAFQADVS-QGPAARRLLEEVQACFSRPPSVVVSCAGITRDEFLLHMSEEDWDRVIAVNLKGTFLVTQAAAQALVSSGGRGSIINISSIIGKV-GNI-GQTNYASSKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKMPEK--VKDKVTAMIPLGHMGDPED-VADVVAFLASEDSGYITG 249          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: YGFF_ECOLI (Uncharacterized oxidoreductase ygfF OS=Escherichia coli (strain K12) GN=ygfF PE=1 SV=2)

HSP 1 Score: 86.6557 bits (213), Expect = 2.059e-16
Identity = 74/245 (30.20%), Postives = 123/245 (50.20%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRID----ALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRM--RDANQEGSVINISSIAATSRGQLPGG-VAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPGTF 715
            TG S G+GR   L LA+ G  +  A      L +  + +N  + +  +A  ++ D+S      EN V   + A  + D    ALVNNAG+     +  +LT E  N ++ TN+TG +L  +    RM  ++    G+++N+SS+A  SR   PG  V YA+SK  ++ +T  LSLE+    IRVN + PG   +E+     +   ++ V S   P++  G  +    ++V +L+ D +    G+F
Sbjct:    7 TGGSRGIGRATALLLAQEGYTV--AVNYQQNLHAAQEVMNLITQAGGKAFVLQADISD-----ENQVVAMFTAIDQHDEPLAALVNNAGILFTQCTVENLTAERINRVLSTNVTGYFLCCREAVKRMALKNGGSGGAIVNVSSVA--SRLGSPGEYVDYAASKGAIDTLTTGLSLEVAAQGIRVNCVRPGFIYTEMHASGGEPGRVDRVKS-NIPMQRGGQAEEVAQAIV-WLLSDKASYVTGSF 240          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: Y325_THEMA (Uncharacterized oxidoreductase TM_0325 OS=Thermotoga maritima GN=TM_0325 PE=3 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 2.059e-16
Identity = 62/200 (31.00%), Postives = 107/200 (53.50%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAA--IENSVQMAWEAFGRIDALVNNAGVS--GAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKK 589
            TGA SG+G++  +  A+ G ++         +  + +E  K++   +++M  E        A   E  V+   E FGR+D LVNNAG+   G ++   + +EE+++  M  N+ G +L+SKY   +M+     G ++N+SS A      +P    Y+ SKA L  +T+ L+++   + IRVN++CPG  +S   EGLM +
Sbjct:   11 TGAGSGIGKKAAVMFAERGAKVA--------INDISEEKGKETVELIKSMGGEAAFIFGDVAKDAEQIVKKTVETFGRLDILVNNAGIVPYGNIE---ETSEEDFDKTMAVNVKGPFLLSKYAVEQMKKQGG-GVIVNVSSEAGLIG--IPRRCVYSVSKAALLGLTRSLAVDYVDYGIRVNAVCPGTTQS---EGLMAR 193          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: PHBB_ZOORA (Acetoacetyl-CoA reductase OS=Zoogloea ramigera GN=phbB PE=3 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 2.059e-16
Identity = 73/237 (30.80%), Postives = 117/237 (49.37%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPGT 712
            TG S G+G    + L  AG ++ A+    D           ++G +V     + DVS+  A +E   ++  +  G ID LVNNAG++        +T ++WN ++ TNLTG + ++  V   MRD +  G ++NISSI    +GQ+ G   Y+++KAG    TK L+ E     I VN+ICPG   +E+   + +K  LN       P+   G  D  +  +V +L  D +    G+
Sbjct:    8 TGGSRGIGAAISIALKAAGYKVAASYAGND---DAAKPFKAETGIAV----YKWDVSSYEACVEGIAKVEAD-LGPIDVLVNNAGITKDAMFH-KMTPDQWNAVINTNLTGLFNMTHPVWSGMRDRSF-GRIVNISSING-QKGQM-GQANYSAAKAGDLGFTKALAQEGAAKGITVNAICPGYIGTEMVRAIPEK-VLNERIIPQIPVGRLGEPD-EIARIVVFLASDEAGFITGS 230          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: GNO_GLUOX (Gluconate 5-dehydrogenase OS=Gluconobacter oxydans GN=gno PE=1 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 2.059e-16
Identity = 62/207 (29.95%), Postives = 103/207 (49.76%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSG---SSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLD-LTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMK----KDWL 598
            TGAS G+G      LA+ G  +V   R  + L S       QSG     ++A     DV+   A I+    +  +  G ID L+NNAG+    ++PL+  + ++W+ +M TN+   + V + V   M    + G ++NI S+   S    PG   Y ++K  +  +TK ++ + G H +++N + PG F +E+TE L+      DWL
Sbjct:   17 TGASRGIGLTLAKGLARYGAEVVLNGRNAESLDSA------QSGFEAEGLKASTAVFDVTDQDAVIDGVAAIERD-MGPIDILINNAGIQR--RAPLEEFSRKDWDDLMSTNVNAVFFVGQAVARHMIPRGR-GKIVNICSVQ--SELARPGIAPYTATKGAVKNLTKGMATDWGRHGLQINGLAPGYFATEMTERLVADEEFTDWL 211          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: BACC_BACSU (Bacilysin biosynthesis oxidoreductase bacC OS=Bacillus subtilis GN=bacC PE=3 SV=2)

HSP 1 Score: 86.6557 bits (213), Expect = 2.059e-16
Identity = 61/202 (30.20%), Postives = 108/202 (53.47%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTE-EEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNN 604
            TG +SG+G  +    A  G +       +D  +    E   +  ++ R   V+ D++ + AA +++V+ A   FG +D L+NNAG+   + +P+   E  +WN +++ NLTG +L+SK+    M  A + G++IN  S+        P   AY +SK G+  +TK ++++   H+IRVN +CPG+  + + E    K +L N
Sbjct:   11 TGGASGIG--YAAVQAFLGQQANVVVADIDEAQG---EAMVRKENNDRLHFVQTDIT-DEAACQHAVESAVHTFGGLDVLINNAGIE--IVAPIHEMELSDWNKVLQVNLTGMFLMSKHALKHMLAAGK-GNIINTCSVGGLVAW--PDIPAYNASKGGVLQLTKSMAVDYAKHQIRVNCVCPGIIDTPLNE----KSFLEN 197          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: Y484_MYCTU (Uncharacterized oxidoreductase Rv0484c/MT0502 OS=Mycobacterium tuberculosis GN=Rv0484c PE=3 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 2.689e-16
Identity = 59/190 (31.05%), Postives = 96/190 (50.53%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEIT 571
            TGASSG+G      LA  G  +VA ARR DR+ +L ++I           A+  DV+ + A     V+    A  R+D LVNNAG +  ++   D   E W  +  TN+ G+  V++ +  ++ D+  +G ++ ++SIAA       GG  Y ++K    A+ + L  EL    +R+  I PG  ++E +
Sbjct:   14 TGASSGIGEATARTLAAQGFHVVAVARRADRITALANQIG--------GTAIVADVTDDAA-----VEALARALSRVDVLVNNAGGAKGLQFVADADLEHWRWMWDTNVLGTLRVTRALLPKLIDSG-DGLIVTVTSIAAIE--VYDGGAGYTAAKHAQGALHRTLRGELLGKPVRLTEIAPGAVETEFS 187          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: PHBB_RHIME (Acetoacetyl-CoA reductase OS=Rhizobium meliloti GN=phbB PE=3 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 2.689e-16
Identity = 74/238 (31.09%), Postives = 120/238 (50.42%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAA-ARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPGT 712
            TG S G+G   C+ L  AG ++ A  A   +R K+      ++SG  V     + DVS+  A ++   ++  +  G +D LVNNAG++        +T E+W  ++ TNLTG + ++  +   MRD    G ++NISSI    +GQ+ G V Y+++KAG   +TK L+ E     I VN+ICPG   +E+   + +K  LN       P+   G  +     +V +L  D +    G+
Sbjct:    8 TGGSRGIGAAICVALKAAGYKVAANYAGNDERAKAF----EQESGIPV----YKWDVSSYQACVDGIARVEAD-LGPVDILVNNAGITRDAMFH-KMTPEQWGEVIGTNLTGVFNMTHPLWSGMRDRGF-GRIVNISSING-QKGQM-GQVNYSAAKAGDLGLTKALAQEGAAKGITVNAICPGYIGTEMVRAVPEK-VLNERIIPQIPVGRLGEPEEVARCVV-FLASDDAGFITGS 230          
The following BLAST results are available for this feature:
BLAST of EY659229 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 262
Match NameE-valueIdentityDescription
CPNA_COMS91.207e-1631.44Cyclopentanol dehydrogenase OS=Comamonas sp. (stra... [more]
Y1627_STAS11.577e-1630.24Uncharacterized oxidoreductase SSP1627 OS=Staphylo... [more]
DHB8_MOUSE1.577e-1628.45Estradiol 17-beta-dehydrogenase 8 OS=Mus musculus ... [more]
YGFF_ECOLI2.059e-1630.20Uncharacterized oxidoreductase ygfF OS=Escherichia... [more]
Y325_THEMA2.059e-1631.00Uncharacterized oxidoreductase TM_0325 OS=Thermoto... [more]
PHBB_ZOORA2.059e-1630.80Acetoacetyl-CoA reductase OS=Zoogloea ramigera GN=... [more]
GNO_GLUOX2.059e-1629.95Gluconate 5-dehydrogenase OS=Gluconobacter oxydans... [more]
BACC_BACSU2.059e-1630.20Bacilysin biosynthesis oxidoreductase bacC OS=Baci... [more]
Y484_MYCTU2.689e-1631.05Uncharacterized oxidoreductase Rv0484c/MT0502 OS=M... [more]
PHBB_RHIME2.689e-1631.09Acetoacetyl-CoA reductase OS=Rhizobium meliloti GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-G11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659229 ID=EY659229|Name=EY659229|organism=Citrus sinensis|type=EST|length=909bp
GACCGGGGCATCCTCCGGTTTAGGCCGAGAATTCTGTCTCGACTTGGCCA
AAGCTGGCTGCCGGATTGTCGCAGCGGCTCGCCGCGTCGACCGGCTCAAG
TCTCTCTGCGACGAGATCAATAAGCAGTCCGGGAGTAGTGTTAGAGCCAT
GGCCGTTGAGCTAGACGTCAGTGCCAATGGAGCCGCTATTGAGAATTCCG
TACAGATGGCTTGGGAAGCCTTCGGCCGAATCGATGCTTTGGTTAATAAT
GCCGGTGTATCAGGTGCTGTGAAGAGTCCATTAGATTTGACGGAGGAGGA
GTGGAATCATATTATGAAAACGAATTTGACAGGGTCTTGGTTGGTTTCGA
AATATGTATGCATCCGCATGCGTGACGCAAATCAGGAAGGATCAGTAATT
AATATATCTTCCATTGCTGCTACTAGCCGTGGACAGCTACCCGGAGGTGT
TGCATATGCTTCTTCAAAAGCAGGCCTAAATGCCATGACAAAGTGTCTGT
CATTGGAACTTGGGGTGCACAAAATCAGAGTCAATTCGATATGCCCTGGA
CTTTTCAAATCTGAAATCACCGAGGGGCTTATGAAAAAAGACTGGCTGAA
TAATGTGGCCTCAAGAACTTACCCTTTAAGAGATTTCGGCACCACCGACC
CCGCACTGACATCGCTTGTTCGGTACCTGGTTCATGACTCTTCTGATATG
TATCCGGGCACATTTTCATTGTTGATTCTGGGGCTACGCTACCANGTCTC
CCTATTTTCTCTTCCCCTTGACTTGTTCGGGAACTTTACAGTCAAATCTC
TTCTATTCTTTAAATCCTTGCTGCAATATATTCTAACACANGAGCATAAA
TGGGCCTGTGCTATTGGGGAAGTACTGCGGTATACTCATTAAAAAAAAAA
AAAAAGAGG
back to top