EY659218

Overview
NameEY659218
Unique NameEY659218
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length881
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2470 contig Csv1_Contig2470:274..1154. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH60_ECO24 (60 kDa chaperonin OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=groL PE=3 SV=1)

HSP 1 Score: 287.73 bits (735), Expect = 5.791e-77
Identity = 150/269 (55.76%), Postives = 197/269 (73.23%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDSE-LADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A  K+  GVN LAD V VTLGPKGRNVVL+  +GAP I  DGV+VA+E+ELED  EN+GA++V++ A+K ND AGDGTTT+ VLAQ +I EG+K VAAG NP+ + RGI+K   A V ELK +S    DS+ +A V  +SA ++  VG +IAEAM KVG++GV+T+E+G   ++ L VVEGMQFDRGY+SPYF+   E  AVE E+  +LL DKKI+N R+++ VLE   +   P+LIIAED+E EAL TLVVN +RG ++ AA+K  G
Sbjct:   12 ARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIITEGLKAVAAGMNPMDLKRGIDKAVTAAVEELKALSVPCSDSKAIAQVGTISANSDETVGKLIAEAMDKVGKEGVITVEDGTGLQDELDVVEGMQFDRGYLSPYFINKPETGAVELESPFILLADKKISNIREMLPVLEAVAKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPG 280          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH60_DEIRA (60 kDa chaperonin OS=Deinococcus radiodurans GN=groL PE=1 SV=3)

HSP 1 Score: 287.73 bits (735), Expect = 5.791e-77
Identity = 144/268 (53.73%), Postives = 197/268 (73.51%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDSELADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A + L+ GVN +A+ V VTLGP+GRNVV+E K+G+P I  DGVTVAKEVELED +ENIGA+L+++ A+KTND+ GDGTTT+ VL Q ++ EG++ VAAGANP+ + RGI+K     + E+K+++  VEDSE     A  + N+  VG  IA AM KVG++GV+T+EE K  +  + VVEGMQFD+G+I+PYF+T+ EKM    E+  +L+ +KKI+N +D++ VLE   +   P+LIIAED+E EAL TLVVNKLRG L  AA+K  G
Sbjct:   11 ARRSLERGVNAVANAVKVTLGPRGRNVVIEKKFGSPTITKDGVTVAKEVELEDKLENIGAQLLKEVASKTNDITGDGTTTATVLGQAIVKEGLRNVAAGANPLALKRGIDKAVAVAIEEIKKLAVSVEDSEAIKKVAGISANDETVGQEIASAMDKVGKEGVITIEESKGFDTEVDVVEGMQFDKGFINPYFITNPEKMEAVLEDAYILINEKKISNLKDMLPVLEKVAQTGRPLLIIAEDVEGEALATLVVNKLRGTLNIAAVKAPG 278          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH60_CITK8 (60 kDa chaperonin OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=groL PE=3 SV=1)

HSP 1 Score: 287.73 bits (735), Expect = 5.791e-77
Identity = 150/269 (55.76%), Postives = 197/269 (73.23%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDSE-LADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A  K+  GVN LAD V VTLGPKGRNVVL+  +GAP I  DGV+VA+E+ELED  EN+GA++V++ A+K ND AGDGTTT+ VLAQ +I EG+K VAAG NP+ + RGI+K   A V ELK +S    DS+ +A V  +SA ++  VG +IAEAM KVG++GV+T+E+G   ++ L VVEGMQFDRGY+SPYF+   E  AVE E+  +LL DKKI+N R+++ VLE   +   P+LIIAED+E EAL TLVVN +RG ++ AA+K  G
Sbjct:   12 ARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQSIITEGLKAVAAGMNPMDLKRGIDKAVAAAVEELKTLSVPCSDSKAIAQVGTISANSDETVGKLIAEAMDKVGKEGVITVEDGTGLQDELDVVEGMQFDRGYLSPYFINKPETGAVELESPFILLADKKISNIREMLPVLEAVAKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPG 280          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH605_BURXL (60 kDa chaperonin 5 OS=Burkholderia xenovorans (strain LB400) GN=groL5 PE=3 SV=1)

HSP 1 Score: 287.73 bits (735), Expect = 5.791e-77
Identity = 147/269 (54.65%), Postives = 197/269 (73.23%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDS-ELADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A  KL  GVN LA+ V VTLGPKGRNVVLE  +G+P +  DGV+VAKE+EL D V+NIGA+LV++ A++T+D AGDGTTT+ VLAQ ++ EG K VAAG NP+ + RGI+K   A + ELK++SK    S E+A VA +SA     +G  IAEA+ +VG++GV+T+E+GKS ++ L VVEG+QFDRGY+SPYF+ D +K     +N  +LL DKK++N RDL+ VLE   + + P+LIIAED+E EAL TLVVN +RG L+  A+K  G
Sbjct:   12 ARSKLVEGVNILANAVKVTLGPKGRNVVLERSFGSPVVTKDGVSVAKEIELPDRVQNIGAQLVKEVASRTSDAAGDGTTTATVLAQAIVREGQKYVAAGLNPLDLKRGIDKAVVAAIDELKKISKPTTTSKEIAQVATISANGEESIGQRIAEAIDRVGKEGVITVEDGKSLDDELDVVEGLQFDRGYLSPYFINDQDKQVAVLDNPYVLLHDKKVSNIRDLLPVLEQVAKASRPLLIIAEDVEGEALATLVVNNIRGILKTVAVKAPG 280          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH601_VIBHA (60 kDa chaperonin 1 OS=Vibrio harveyi GN=groL1 PE=3 SV=1)

HSP 1 Score: 287.73 bits (735), Expect = 5.791e-77
Identity = 147/269 (54.65%), Postives = 201/269 (74.72%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDSE-LADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A  K+  GVN LAD V VTLGPKGRNVVL+  +GAP I  DGV+VA+E+ELED  +N+GA++V++ A+K ND AGDGTTT+ VLAQ ++ EG+K VAAG NP+ + RGI+K   A V + K+ S E  D++ +A V  +SA ++  VGN+IAEAM KVGR GV+T+EEG++ ++ L VVEGMQFDRGY+SPYF+ + E  +V+ EN  +LL+DKK++N R+L+  LE   + + P+LIIAED+E EAL TLVVN +RG ++ AA+K  G
Sbjct:   12 ARVKMLEGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREIELEDKFQNMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGIDKAVIAAVEQPKRASVECTDTKAIAQVGTISANSDSSVGNIIAEAMEKVGRDGVITVEEGQALQDELDVVEGMQFDRGYLSPYFINNQEAGSVDLENPFILLIDKKVSNIRELLPALEAVAKASRPLLIIAEDVEGEALATLVVNNMRGIVKVAAVKAPG 280          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH601_SYNS3 (60 kDa chaperonin 1 OS=Synechococcus sp. (strain CC9311) GN=groL1 PE=3 SV=1)

HSP 1 Score: 287.73 bits (735), Expect = 5.791e-77
Identity = 144/263 (54.75%), Postives = 191/263 (72.62%), Query Frame = 3
Query:   36 KKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDSELADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALK 824
            + L+ G+N LAD V VT+GP+GRNVVLE  YG+P IVNDG T+AKE+EL DP ENIGAKL++Q A+KT D AGDGTTT+ VLAQ ++ EG++  AAGA+P+ + RG+EK   A+V+ L Q S+ V    +  VA VS+G + EVG M+AEAM +V   GV+T+EE KS    L V EGM FDRGY SPYFVTD ++   E+EN  LLL D+KI++  DL+ VLE   +   P++I+AE+++ EAL TLVVNK RG L+ AA++
Sbjct:   13 ESLERGMNALADAVRVTIGPRGRNVVLEKSYGSPDIVNDGDTIAKEIELADPFENIGAKLIQQVASKTKDKAGDGTTTATVLAQAMVEEGLRNTAAGASPIELRRGMEKAVAAVVASLNQRSQSVSGDAIRQVATVSSGGDEEVGRMVAEAMDRVSFDGVITVEESKSLATELEVTEGMAFDRGYSSPYFVTDGDRQICEFENALLLLTDRKISSVTDLVPVLETVQKSGSPLVILAEEVDGEALATLVVNKNRGVLQVAAVR 275          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH601_ECOK1 (60 kDa chaperonin 1 OS=Escherichia coli O1:K1 / APEC GN=groL1 PE=3 SV=1)

HSP 1 Score: 287.73 bits (735), Expect = 5.791e-77
Identity = 150/269 (55.76%), Postives = 197/269 (73.23%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDSE-LADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A  K+  GVN LAD V VTLGPKGRNVVL+  +GAP I  DGV+VA+E+ELED  EN+GA++V++ A+K ND AGDGTTT+ VLAQ +I EG+K VAAG NP+ + RGI+K   A V ELK +S    DS+ +A V  +SA ++  VG +IAEAM KVG++GV+T+E+G   ++ L VVEGMQFDRGY+SPYF+   E  AVE E+  +LL DKKI+N R+++ VLE   +   P+LIIAED+E EAL TLVVN +RG ++ AA+K  G
Sbjct:   12 ARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIITEGLKAVAAGMNPMDLKRGIDKAVTAAVEELKALSVPCSDSKAIAQVGTISANSDETVGKLIAEAMDKVGKEGVITVEDGTGLQDELDVVEGMQFDRGYLSPYFINKPETGAVELESPFILLADKKISNIREMLPVLEAVAKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPG 280          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH60_TERTT (60 kDa chaperonin OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=groL PE=3 SV=1)

HSP 1 Score: 287.345 bits (734), Expect = 7.564e-77
Identity = 146/269 (54.28%), Postives = 202/269 (75.09%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDSE-LADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A +K+  GVN LAD V  TLGPKGRNVVL+  +GAP +  DGV+VAKE+EL+D  EN+GA++V++ A+K +D AGDGTTT+ VLAQ ++ EG+K VAAG NP+ + RGI+K   A V  +K  ++  EDS+ +A V  +SA ++  +G++IAEAM KVG++GV+T+EEG   EN L VVEGMQFDRGY+SPYF+T+ + M+VE+E+  +LLVDKKI+N R+L+ VLE   +   P++I+AED+E EAL TLVVN +RG ++ AA K  G
Sbjct:   12 ARQKMLVGVNVLADAVKTTLGPKGRNVVLDKAFGAPTVTKDGVSVAKEIELKDKFENMGAQMVKEVASKASDDAGDGTTTATVLAQAIVNEGLKSVAAGMNPMDLKRGIDKAVAAAVEFVKSSAQPCEDSKSIAQVGTISANSDSHIGDIIAEAMEKVGKEGVITVEEGSGLENELDVVEGMQFDRGYLSPYFITNQDNMSVEHESPFILLVDKKISNIRELLPVLEAVAKAGKPLVIVAEDVEGEALATLVVNNMRGIVKVAACKAPG 280          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH60_SODGM (60 kDa chaperonin OS=Sodalis glossinidius (strain morsitans) GN=groL PE=1 SV=1)

HSP 1 Score: 287.345 bits (734), Expect = 7.564e-77
Identity = 151/269 (56.13%), Postives = 198/269 (73.61%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDSE-LADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A  K+  GVN LAD V VTLGPKGRNVVL+  +GAP I  DGV+VA+E+ELED  EN+GA++V++ A+K ND AGDGTTT+ VLAQ ++ EG+K VAAG NP+ + RGI+K   A V ELK++S    DS+ +A V  +SA  +  VG +IAEAM+KVG++GV+T+EEG   ++ L VVEGMQFDRGY+SPYFV   E  AVE E+  +LL DKKI+N R+++ VLE   +   P+LIIAED+E EAL TLVVN +RG ++ AA+K  G
Sbjct:   12 ARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGAPVITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQSIVNEGLKAVAAGMNPMDLKRGIDKAVIAAVEELKKLSVPCSDSKAIAQVGTISANADETVGTLIAEAMAKVGKEGVITVEEGSGLQDELDVVEGMQFDRGYLSPYFVNKPETGAVELESPFILLADKKISNIREMLPVLEAVAKAGKPLLIIAEDVEGEALATLVVNTMRGIVKIAAVKAPG 280          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH60_SODGL (60 kDa chaperonin OS=Sodalis glossinidius GN=groL PE=3 SV=1)

HSP 1 Score: 287.345 bits (734), Expect = 7.564e-77
Identity = 151/269 (56.13%), Postives = 198/269 (73.61%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDSE-LADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A  K+  GVN LAD V VTLGPKGRNVVL+  +GAP I  DGV+VA+E+ELED  EN+GA++V++ A+K ND AGDGTTT+ VLAQ ++ EG+K VAAG NP+ + RGI+K   A V ELK++S    DS+ +A V  +SA  +  VG +IAEAM+KVG++GV+T+EEG   ++ L VVEGMQFDRGY+SPYFV   E  AVE E+  +LL DKKI+N R+++ VLE   +   P+LIIAED+E EAL TLVVN +RG ++ AA+K  G
Sbjct:   12 ARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGAPVITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQSIVNEGLKAVAAGMNPMDLKRGIDKAVIAAVEELKKLSVPCSDSKAIAQVGTISANADETVGTLIAEAMAKVGKEGVITVEEGSGLQDELDVVEGMQFDRGYLSPYFVNKPETGAVELESPFILLADKKISNIREMLPVLEAVAKAGKPLLIIAEDVEGEALATLVVNTMRGIVKIAAVKAPG 280          
The following BLAST results are available for this feature:
BLAST of EY659218 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CH60_ECO245.791e-7755.7660 kDa chaperonin OS=Escherichia coli O139:H28 (st... [more]
CH60_DEIRA5.791e-7753.7360 kDa chaperonin OS=Deinococcus radiodurans GN=gr... [more]
CH60_CITK85.791e-7755.7660 kDa chaperonin OS=Citrobacter koseri (strain AT... [more]
CH605_BURXL5.791e-7754.6560 kDa chaperonin 5 OS=Burkholderia xenovorans (st... [more]
CH601_VIBHA5.791e-7754.6560 kDa chaperonin 1 OS=Vibrio harveyi GN=groL1 PE=... [more]
CH601_SYNS35.791e-7754.7560 kDa chaperonin 1 OS=Synechococcus sp. (strain C... [more]
CH601_ECOK15.791e-7755.7660 kDa chaperonin 1 OS=Escherichia coli O1:K1 / AP... [more]
CH60_TERTT7.564e-7754.2860 kDa chaperonin OS=Teredinibacter turnerae (stra... [more]
CH60_SODGM7.564e-7756.1360 kDa chaperonin OS=Sodalis glossinidius (strain ... [more]
CH60_SODGL7.564e-7756.1360 kDa chaperonin OS=Sodalis glossinidius GN=groL ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-F11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659218 ID=EY659218|Name=EY659218|organism=Citrus sinensis|type=EST|length=881bp
AGAACTTGCATTTCAACAAGNATGGATATGCCATGAAGAAACTTCAAAAT
GGTGTCAACAAGCTTGCAGATCTAGTTGGAGTTACCCTTGGTCCCAAGGG
CAGGAATGTTGTTCTAGAGAGCAAGTACGGTGCCCCAAAAATTGTGAATG
ATGGTGTAACTGTGGCCAAAGAAGTTGAGTTAGAGGACCCGGTTGAGAAC
ATTGGTGCTAAATTAGTGAGACAAGCAGCTGCCAAGACTAATGACTTGGC
TGGTGATGGAACAACAACATCTGTTGTTCTTGCGCAAGGGCTTATAGCTG
AAGGTGTTAAGGTCGTGGCAGCTGGTGCAAATCCTGTTCTTATCACAAGA
GGCATTGAGAAGACATCTAAGGCTCTTGTTTCTGAGCTCAAGCAGATGTC
AAAAGAGGTTGAAGATAGTGAACTTGCCGATGTAGCAGCTGTTAGTGCAG
GGAACAACTATGAAGTTGGGAATATGATTGCAGAAGCCATGAGTAAAGTG
GGACGTAAGGGTGTGGTGACCCTTGAAGAGGGAAAAAGTGCTGAGAATAT
GCTCTATGTTGTTGAGGGAATGCAATTTGATCGTGGTTATATTTCTCCCT
ACTTCGTCACTGATAGTGAGAAAATGGCAGTTGAATATGAGAACTGCAAG
TTGCTTCTTGTGGATAAAAAGATTACCAATGCAAGGGACCTTATCAACGT
TTTGGAAGATGCGATTAGAGGTGCATACCCAATTTTGATTATTGCAGAAG
ATATTGAGCAAGAAGCACTGGGCACTCTTGTCGTGAACAAGCTGAGAGGT
GCATTGGAGAATGCTGCTCTTAAGCTCCTGGGTTTGAGAGCGGCAGAGCA
GTACCTTGAGACATTGCTTTTTGACTGGAGG
back to top