EY659218

Overview
NameEY659218
Unique NameEY659218
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length881
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2470 contig Csv1_Contig2470:274..1154. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH602_AZOC5 (60 kDa chaperonin 2 OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / ORS 571) GN=groL2 PE=3 SV=1)

HSP 1 Score: 300.827 bits (769), Expect = 6.611e-81
Identity = 153/271 (56.46%), Postives = 208/271 (76.75%), Query Frame = 3
Query:   24 GYAMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEV-EDSELADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            G A +K+  GV+ LA+ V VTLGPKGRNVV+E  +GAP+I  DGV+VAKE+ELED  EN+GA+LVR+ A+KTNDLAGDGTTT+ VLAQ ++ EG K VAAG NP+ + RGI+    A+V +L   +K+V  ++E+A V  +SA  + +VG  +AEAM KVG +GV+T+EE K+AE  L VVEGMQFDRGY+SPYFVT++EKM VE+E+  +L+ +KK++N ++L+ VLE  ++   P++I+AED+E EAL TLVVNKLRG L+ AA+K  G
Sbjct:   10 GDAREKMLRGVDILANAVKVTLGPKGRNVVIEKSFGAPRITKDGVSVAKEIELEDKFENLGAQLVREVASKTNDLAGDGTTTATVLAQAIVKEGSKAVAAGMNPMDLKRGIDLAVDAIVKDLAAKAKKVTSNAEIAQVGTISANGDADVGKFLAEAMQKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFVTNAEKMRVEFEDPYILIHEKKLSNLQELLPVLEAVVQSGKPLVIVAEDVEGEALATLVVNKLRGGLKVAAVKAPG 280          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH601_PROMT (60 kDa chaperonin 1 OS=Prochlorococcus marinus (strain NATL2A) GN=groL1 PE=3 SV=1)

HSP 1 Score: 300.827 bits (769), Expect = 6.611e-81
Identity = 153/269 (56.88%), Postives = 201/269 (74.72%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDSE-LADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A + L+ G++ LA+ V VTLGPKGRNVVLE K+GAP+I+NDGVT+AKE+ELED +EN G  L+RQAA+KTND AGDGTTT+ VLA  ++  G+K VAAGAN + + +GI+K ++ LV ++K  SK + DS  +A    ++AGN+ EVG MIA+AM KVG++GV++LEEGKS    L V EGM+FD+GYISPYF TD+E+M    +   +LL DKKI   +DL+ VLE   +   P+LIIAEDIE+EAL TLVVN+LRG L  AA+K  G
Sbjct:   11 ARRALERGIDILAESVAVTLGPKGRNVVLEKKFGAPQIINDGVTIAKEIELEDHIENTGVALIRQAASKTNDAAGDGTTTATVLAHAMVKAGLKNVAAGANAITLKKGIDKATEFLVEKIKDHSKPISDSNAIAQCGTIAAGNDEEVGKMIADAMDKVGKEGVISLEEGKSMTTELEVTEGMRFDKGYISPYFATDTERMEAVLDEPYILLTDKKIGLVQDLVPVLEQVAKTGKPLLIIAEDIEKEALATLVVNRLRGVLNVAAVKAPG 279          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH60_GEMAT (60 kDa chaperonin OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=groL PE=3 SV=1)

HSP 1 Score: 300.056 bits (767), Expect = 1.128e-80
Identity = 156/277 (56.32%), Postives = 200/277 (72.20%), Query Frame = 3
Query:    6 LHFNKXGYAMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDS-ELADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            LHFN    A   L+ GV++LA+ V VTLGPKGRNVV++ K+GAP +  DGVTVAKE+EL DP+EN+GA++V++ A KT+DLAGDGTTT+ VLAQ +  EG+K V AG+NP+ + RGIEK    +V ELK++S       E+A V  +SA N+ E+GN+IAEAM KVG+ GV+T+EE K  E  L  V+GMQFDRGY+SPYFVTD EKM    EN  +L+ DKKI+  +DL+  LE   +   P+LIIAED+E EAL TLVVNKLRG L   A+K  G
Sbjct:    6 LHFNVDARAA--LKRGVDQLAEAVKVTLGPKGRNVVIDKKFGAPTVTKDGVTVAKEIELADPIENMGAQMVKEVATKTSDLAGDGTTTATVLAQAIFREGLKNVTAGSNPMALKRGIEKAVAGIVEELKRISVPTTGKKEIAQVGTISANNDPEIGNLIAEAMEKVGKDGVITVEEAKGLETTLETVDGMQFDRGYLSPYFVTDPEKMEAVLENALILIHDKKISAMKDLLPALEKVAQLGKPLLIIAEDVEGEALATLVVNKLRGTLRICAVKAPG 280          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH60_AMOA5 (60 kDa chaperonin OS=Amoebophilus asiaticus (strain 5a2) GN=groL PE=3 SV=1)

HSP 1 Score: 300.056 bits (767), Expect = 1.128e-80
Identity = 151/269 (56.13%), Postives = 208/269 (77.32%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDS-ELADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A  KL++GV+ +A+ V VTLGPKGRNVV++ KYGAP I  DG++VAKE+EL+DPVEN+GA+L+++ A+KT D AGDGTTT+ VLAQ + + G+K VAAGANP+ + RG++K  +A+V  LKQ S+++ +S E+  VA +SA N+ ++G MIA+AM KVG+ GV+T+EE K  E  + VVEGM+FDRGY+SPYFVT++EKM  E  N  +L+ DKKI+  ++L+ +LE   +   P+LIIAEDIE EAL TLVVNK+RGAL+ AA+K  G
Sbjct:   11 ARAKLKSGVDTMANAVKVTLGPKGRNVVIDKKYGAPSITKDGISVAKEIELKDPVENLGAQLIKEVASKTADGAGDGTTTATVLAQSIFSAGIKNVAAGANPMDLKRGVDKAIEAVVERLKQNSRKISNSKEIEQVATISANNDSKIGKMIADAMDKVGKDGVITVEEAKGTETEVKVVEGMEFDRGYLSPYFVTNTEKMEAELGNAYILICDKKISVMKELLPILEAISQTGRPLLIIAEDIEGEALATLVVNKIRGALKVAAVKAPG 279          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH602_PROM1 (60 kDa chaperonin 2 OS=Prochlorococcus marinus (strain NATL1A) GN=groL2 PE=3 SV=1)

HSP 1 Score: 300.056 bits (767), Expect = 1.128e-80
Identity = 153/269 (56.88%), Postives = 200/269 (74.35%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDSE-LADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A + L+ G++ LA+ V VTLGPKGRNVVLE K+GAP+I+NDGVT+AKE+ELED +EN G  L+RQAA+KTND AGDGTTT+ VLA  ++  G+K VAAGAN + + +GI+K +  LV ++K  SK + DS  +A    ++AGN+ EVG MIA+AM KVG++GV++LEEGKS    L V EGM+FD+GYISPYF TD+E+M    +   +LL DKKI   +DL+ VLE   +   P+LIIAEDIE+EAL TLVVN+LRG L  AA+K  G
Sbjct:   11 ARRALERGIDILAESVAVTLGPKGRNVVLEKKFGAPQIINDGVTIAKEIELEDHIENTGVALIRQAASKTNDAAGDGTTTATVLAHAMVKAGLKNVAAGANAITLKKGIDKATDFLVEKIKDHSKPISDSNAIAQCGTIAAGNDEEVGKMIADAMDKVGKEGVISLEEGKSMTTELEVTEGMRFDKGYISPYFATDTERMEAVLDEPYILLTDKKIGLVQDLVPVLEQVAKTGKPLLIIAEDIEKEALATLVVNRLRGVLNVAAVKAPG 279          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH602_ANADF (60 kDa chaperonin 2 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=groL2 PE=3 SV=1)

HSP 1 Score: 300.056 bits (767), Expect = 1.128e-80
Identity = 153/269 (56.88%), Postives = 201/269 (74.72%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDS-ELADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A   +  GVN LAD V VTLGPKGRNVV+E  +G+P I  DGVTVAKE+ELE+  EN+GA++V++ A+KT+D+AGDGTTT+ VLAQ L  EG K+VAAG NP+ I RGI+K  + +V ELK++SK  +D  E+A V  +SA  +  +GN+IAEAM KVG++GV+T+EE K  E  L VVEGMQFDRGY+SPYFVTD+E+M    E+  +L+ +KKI+N +DL+ +LE   R   P+LI+AE++E EAL TLVVNKLRG L  AA+K  G
Sbjct:   12 ARDAILKGVNTLADAVKVTLGPKGRNVVIEKSFGSPTITKDGVTVAKEIELENKFENMGAQMVKEVASKTSDVAGDGTTTATVLAQALYREGSKLVAAGHNPMEIKRGIDKAVEIIVGELKKLSKPTKDQKEIAQVGIISANGDETIGNIIAEAMEKVGKEGVITVEEAKGLETTLEVVEGMQFDRGYLSPYFVTDAERMVANLEDAYILIHEKKISNMKDLLPLLEQIARSGKPLLIVAEEVEGEALATLVVNKLRGTLHVAAVKAPG 280          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH60_PSEPG (60 kDa chaperonin OS=Pseudomonas putida (strain GB-1) GN=groL PE=3 SV=1)

HSP 1 Score: 299.671 bits (766), Expect = 1.473e-80
Identity = 155/269 (57.62%), Postives = 200/269 (74.35%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDSE-LADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A KK+  GVN LAD V  TLGPKGRNVVL   +GAP I  DGV+VAKE+EL+D  EN+GA+LV++ A+K ND AGDGTTT+ VLAQ ++ EG+K VAAG NP+ + RGI+K + A+V+ELK +SK   DS+ +A V  +SA ++  +GN+IAEAM KVG++GV+T+EEG   EN L VVEGMQFDRGY+SPYFV   + M  E E   LLLVDKKI+N R+L+ VLE   +   P+LI+AED+E EAL TLVVN +RG ++ AA+K  G
Sbjct:   12 ARKKMLVGVNVLADAVKATLGPKGRNVVLAKSFGAPTITKDGVSVAKEIELKDAFENMGAQLVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGIDKATAAVVAELKNLSKPCADSKAIAQVGTISANSDDSIGNIIAEAMEKVGKEGVITVEEGSGLENELSVVEGMQFDRGYLSPYFVNKPDTMVAELEGPLLLLVDKKISNIRELLPVLEAVAKAGRPLLIVAEDVEGEALATLVVNNMRGIVKVAAVKAPG 280          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH60_CYTH3 (60 kDa chaperonin OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=groL PE=3 SV=1)

HSP 1 Score: 299.671 bits (766), Expect = 1.473e-80
Identity = 147/269 (54.65%), Postives = 208/269 (77.32%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDS-ELADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A +KL+ GV+ LAD V VTLGPKGRNV+L+ K+G+P I  DGV+VAK++EL+D +EN+GA+LV++ A+KT D AGDGTTT+ VL Q +   G+K VAAGANP+ + RGI+K   A++++LK  SK++ +S E+A VA +SA N++E+G MIA AM KVG+ GV+T+EE K  E  +  VEGMQFDRGY+SPYFVT+++KM VE +   +L+ DKK+++ ++L+ +LE  ++   P+LIIAED++ EAL TLVVNK+RGAL+ AA+K  G
Sbjct:   11 AREKLKKGVDALADAVKVTLGPKGRNVILDKKFGSPAITKDGVSVAKDIELKDAIENMGAQLVKEVASKTADQAGDGTTTATVLTQAIFNAGLKNVAAGANPMDLKRGIDKAVSAIIADLKVQSKKISNSNEIAQVATISANNDHEIGKMIAHAMDKVGKDGVITVEEAKGTETEVKTVEGMQFDRGYLSPYFVTNTDKMEVELDRPYILIYDKKVSSMKELLPILEQVVQSGRPLLIIAEDVDGEALATLVVNKIRGALKIAAVKAPG 279          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH60_CARHZ (60 kDa chaperonin OS=Carboxydothermus hydrogenoformans (strain Z-2901 / DSM 6008) GN=groL PE=3 SV=1)

HSP 1 Score: 299.671 bits (766), Expect = 1.473e-80
Identity = 155/269 (57.62%), Postives = 202/269 (75.09%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDSE-LADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A + L+ GVN LAD V VTLGPKGRNVVLE K+G+P+I+NDGV++A+E+EL DPVEN+GA+LV++ A KTND+AGDGTTT+ VLAQ +I EG+K V AGANP+++ +GIEK     V E+K ++K VE SE +A VAA+SA N+ E+G +IAEAM KVG+ GV+T+EE +     L VVEGM FDRGYISPY +TD +KM     +  +L+ DKKI+   DL+ +LE  ++   P+LIIAED+E EAL TLVVNKLRG L   A+K  G
Sbjct:   12 ARRALERGVNALADAVKVTLGPKGRNVVLEKKFGSPQIINDGVSIAREIELADPVENMGAQLVKEVATKTNDVAGDGTTTATVLAQAIIREGLKNVTAGANPMILRKGIEKAVAKAVEEIKAIAKPVETSEAIAQVAAISA-NDEEIGKLIAEAMEKVGKDGVITVEESQGLGTTLEVVEGMSFDRGYISPYMITDPDKMEAILNDPYILITDKKISAIADLLPILEKVVQTGKPLLIIAEDVEGEALATLVVNKLRGTLTCVAVKAPG 279          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH60_CAMC1 (60 kDa chaperonin OS=Campylobacter concisus (strain 13826) GN=groL PE=3 SV=1)

HSP 1 Score: 299.671 bits (766), Expect = 1.473e-80
Identity = 153/269 (56.88%), Postives = 200/269 (74.35%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDS-ELADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A  +L  GV KL D V VT+GP+GRNV+++  +GAP I  DGV+VAKEVEL+D +EN+GA LVR+ A+KTND AGDGTTT+ VLA  +  EG++ V AGANP+ + RG++K   AL+  LK +SK+V  S E+A +A +SA ++  +G +IA+AM KVG+ GV+T+EE KS ++ L VVEGMQFDRGY+SPYF+T+ EKM VE  N  +LL DKKITN +DL+ VLE   +   P+LIIAEDIE EAL TLVVNKLRG L  +A+K  G
Sbjct:   11 ARNRLYEGVKKLNDAVKVTMGPRGRNVLIQKSFGAPNITKDGVSVAKEVELKDTIENMGASLVREVASKTNDQAGDGTTTATVLAHAIFKEGLRNVTAGANPIEVKRGMDKEVAALIDALKNISKKVSGSKEIAQIATISANSDESIGKLIADAMEKVGKDGVITVEEAKSIQDELSVVEGMQFDRGYLSPYFITNPEKMQVELSNPFILLFDKKITNLKDLLPVLEQVQKSGKPLLIIAEDIEGEALATLVVNKLRGVLNISAVKAPG 279          
The following BLAST results are available for this feature:
BLAST of EY659218 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CH602_AZOC56.611e-8156.4660 kDa chaperonin 2 OS=Azorhizobium caulinodans (s... [more]
CH601_PROMT6.611e-8156.8860 kDa chaperonin 1 OS=Prochlorococcus marinus (st... [more]
CH60_GEMAT1.128e-8056.3260 kDa chaperonin OS=Gemmatimonas aurantiaca (stra... [more]
CH60_AMOA51.128e-8056.1360 kDa chaperonin OS=Amoebophilus asiaticus (strai... [more]
CH602_PROM11.128e-8056.8860 kDa chaperonin 2 OS=Prochlorococcus marinus (st... [more]
CH602_ANADF1.128e-8056.8860 kDa chaperonin 2 OS=Anaeromyxobacter sp. (strai... [more]
CH60_PSEPG1.473e-8057.6260 kDa chaperonin OS=Pseudomonas putida (strain GB... [more]
CH60_CYTH31.473e-8054.6560 kDa chaperonin OS=Cytophaga hutchinsonii (strai... [more]
CH60_CARHZ1.473e-8057.6260 kDa chaperonin OS=Carboxydothermus hydrogenofor... [more]
CH60_CAMC11.473e-8056.8860 kDa chaperonin OS=Campylobacter concisus (strai... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-F11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659218 ID=EY659218|Name=EY659218|organism=Citrus sinensis|type=EST|length=881bp
AGAACTTGCATTTCAACAAGNATGGATATGCCATGAAGAAACTTCAAAAT
GGTGTCAACAAGCTTGCAGATCTAGTTGGAGTTACCCTTGGTCCCAAGGG
CAGGAATGTTGTTCTAGAGAGCAAGTACGGTGCCCCAAAAATTGTGAATG
ATGGTGTAACTGTGGCCAAAGAAGTTGAGTTAGAGGACCCGGTTGAGAAC
ATTGGTGCTAAATTAGTGAGACAAGCAGCTGCCAAGACTAATGACTTGGC
TGGTGATGGAACAACAACATCTGTTGTTCTTGCGCAAGGGCTTATAGCTG
AAGGTGTTAAGGTCGTGGCAGCTGGTGCAAATCCTGTTCTTATCACAAGA
GGCATTGAGAAGACATCTAAGGCTCTTGTTTCTGAGCTCAAGCAGATGTC
AAAAGAGGTTGAAGATAGTGAACTTGCCGATGTAGCAGCTGTTAGTGCAG
GGAACAACTATGAAGTTGGGAATATGATTGCAGAAGCCATGAGTAAAGTG
GGACGTAAGGGTGTGGTGACCCTTGAAGAGGGAAAAAGTGCTGAGAATAT
GCTCTATGTTGTTGAGGGAATGCAATTTGATCGTGGTTATATTTCTCCCT
ACTTCGTCACTGATAGTGAGAAAATGGCAGTTGAATATGAGAACTGCAAG
TTGCTTCTTGTGGATAAAAAGATTACCAATGCAAGGGACCTTATCAACGT
TTTGGAAGATGCGATTAGAGGTGCATACCCAATTTTGATTATTGCAGAAG
ATATTGAGCAAGAAGCACTGGGCACTCTTGTCGTGAACAAGCTGAGAGGT
GCATTGGAGAATGCTGCTCTTAAGCTCCTGGGTTTGAGAGCGGCAGAGCA
GTACCTTGAGACATTGCTTTTTGACTGGAGG
back to top