DR405977

Overview
NameDR405977
Unique NameDR405977
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length727
Libraries
Library NameType
Mature Juice Sac from Navel Orange in pTriplEx2 vectorcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6306 contig Csv1_Contig6306:1..727. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DR405977 vs. ExPASy Swiss-Prot
Match: GALE_PASHA (UDP-glucose 4-epimerase OS=Pasteurella haemolytica GN=galE PE=3 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 1.721e-38
Identity = 82/185 (44.32%), Postives = 123/185 (66.49%), Query Frame = 3
Query:  171 ILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPL-EAMNPYGRTKLFIEEICRDVHRSDSEWKIILLRYFNPVGAH 722
            ILVTGGAGYIGSHT+++LL    + VV+DNL N+SE+++ +VK++ G    ++ F++ D+ D+  L  +FA+ +  +VIHFAGL+AVGE+ +   +   NN+ G+I L+E M       +VFSSSATVYG P+++P  E  P+    NPYG +K  +E I  D  ++  +   ++LRYFN VGAH
Sbjct:    3 ILVTGGAGYIGSHTLVELLNENREIVVLDNLSNSSEVSLERVKQITGK---SVKFYQGDILDRDILRKIFAENQIESVIHFAGLKAVGETSENRYVTIKNNVTGSIVLVEEMLKANVNTIVFSSSATVYGDPQIIPIVESCPVGGTTNPYGTSKYMVERILEDTVKAFPQLSAVVLRYFNRVGAH 184          
BLAST of DR405977 vs. ExPASy Swiss-Prot
Match: ARAE1_ARATH (UDP-arabinose 4-epimerase 1 OS=Arabidopsis thaliana GN=MUR4 PE=1 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 5.008e-38
Identity = 82/186 (44.09%), Postives = 115/186 (61.83%), Query Frame = 3
Query:  168 NILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPLEAMNPYGRTKLFIEEICRDVHRSDSEWKIILLRYFNPVGAHP 725
            ++LVTGGAGYIGSH  L+LL   Y+  +VDNL   +  AV  ++EL    G  + F   DL D  A+  +F +  F AV+HFA +  VGES Q PL Y+ N    T+ +LE MAAHG K L++SS+   YG P ++P TEE P   +NPYG+ K   E+I  D  + +S+  +++LRYFN +G+ P
Sbjct:   72 HVLVTGGAGYIGSHAALRLLKESYRVTIVDNLSRGNLAAVRILQELFPEPG-RLQFIYADLGDAKAVNKIFTENAFDAVMHFAAVAYVGESTQFPLKYYHNITSNTLVVLETMAAHGVKTLIYSSTCATYGEPDIMPITEETPQVPINPYGKAKKMAEDIILDFSK-NSDMAVMILRYFNVIGSDP 255          
BLAST of DR405977 vs. ExPASy Swiss-Prot
Match: ARAE2_ARATH (Putative UDP-arabinose 4-epimerase 2 OS=Arabidopsis thaliana GN=At2g34850 PE=2 SV=3)

HSP 1 Score: 152.91 bits (385), Expect = 1.611e-36
Identity = 81/186 (43.55%), Postives = 115/186 (61.83%), Query Frame = 3
Query:  168 NILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPLEAMNPYGRTKLFIEEICRDVHRSDSEWKIILLRYFNPVGAHP 725
            ++LVTGGAGYIGSH  L+LL   Y+  +VDNL   +  AV  +++L    G  + F   DL D  A+  +F++  F AV+HFA +  VGES Q PL Y+ N    T+ +LE MAAHG K L++SS+   YG P+ +P TEE P   +NPYG+ K   E+I  D  + +S   +++LRYFN +G+ P
Sbjct:   71 HVLVTGGAGYIGSHAALRLLKDSYRVTIVDNLSRGNLGAVKILQQLFPEPG-KLQFIYADLGDANAVNKIFSENAFDAVMHFAAVAYVGESTQFPLKYYHNITSNTLVVLETMAAHGVKTLIYSSTCATYGEPEKMPITEETPQVPINPYGKAKKMAEDIILDFSK-NSIMAVMILRYFNVIGSDP 254          
BLAST of DR405977 vs. ExPASy Swiss-Prot
Match: ARAE2_ORYSJ (Probable UDP-arabinose 4-epimerase 2 OS=Oryza sativa subsp. japonica GN=UEL-2 PE=2 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 1.044e-35
Identity = 79/186 (42.47%), Postives = 112/186 (60.22%), Query Frame = 3
Query:  168 NILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPLEAMNPYGRTKLFIEEICRDVHRSDSEWKIILLRYFNPVGAHP 725
            ++LVTGGAGYIGSH  L+LL   Y+  +VDNL   +  AV  ++ L    G  + F   DL D  A+  +F++  F AV+HFA +  VGES  +PL Y+ N    T+T+LE MAA+  K L++SS+   YG P  +P TE  P   +NPYG+ K   E+I  D  +  SE  +++LRYFN +G+ P
Sbjct:   51 HVLVTGGAGYIGSHATLRLLRDNYRVTIVDNLSRGNMGAVRVLQRLFPEPG-RLQFIYADLGDAKAVNKIFSENAFDAVMHFAAVAYVGESTLEPLRYYHNITSNTLTVLEAMAAYNVKTLIYSSTCATYGEPDTMPITEATPQNPINPYGKAKKMAEDIILDFSKR-SEMAVMILRYFNVIGSDP 234          
BLAST of DR405977 vs. ExPASy Swiss-Prot
Match: ARAE3_ORYSJ (Probable UDP-arabinose 4-epimerase 3 OS=Oryza sativa subsp. japonica GN=UEL-3 PE=2 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 5.182e-35
Identity = 76/186 (40.86%), Postives = 111/186 (59.68%), Query Frame = 3
Query:  168 NILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPLEAMNPYGRTKLFIEEICRDVHRSDSEWKIILLRYFNPVGAHP 725
            ++LVTGGAGYIGSH  L+LL   Y+  +VDNL   +  AV  ++EL    G  + F   DL D+  +  +FA+  F AV+HFA +  VGES  +PL Y+ N    T+ +LE MA+HG K L++SS+   YG P+ +P  E      +NPYG+ K   E+I  D  +   +  +++LRYFN +G+ P
Sbjct:   65 HVLVTGGAGYIGSHASLRLLKDNYRVTIVDNLSRGNMGAVKVLQELFPQPG-RLQFIYADLGDQKTVNKIFAENAFDAVMHFAAVAYVGESTLEPLRYYHNITSNTLLILEAMASHGVKTLIYSSTCATYGEPEKMPIVETTRQLPINPYGKAKKMAEDIILDFTKGRKDMAVMILRYFNVIGSDP 249          
BLAST of DR405977 vs. ExPASy Swiss-Prot
Match: ARAE4_ARATH (Putative UDP-arabinose 4-epimerase 4 OS=Arabidopsis thaliana GN=At5g44480 PE=3 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 6.769e-35
Identity = 77/186 (41.40%), Postives = 114/186 (61.29%), Query Frame = 3
Query:  168 NILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPLEAMNPYGRTKLFIEEICRDVHRSDSEWKIILLRYFNPVGAHP 725
            ++LVTGGAGYIGSH  L+LL   Y+  +VDNL   +  AV  +++L    G  + F   DL D  A+E +F++  F AV+HFA +  VGES   PL Y+ N    T+ +LE MA H  K L++SS+   YG P+ +P TE+ P   +NPYG+ K   E++  D  + +S+  +++LRYFN +G+ P
Sbjct:   96 HVLVTGGAGYIGSHAALRLLRDSYRVTIVDNLSRGNLGAVKTLQQLFPQTG-RLQFIYADLGDPLAVEKIFSENAFDAVMHFAAVAYVGESTLYPLKYYHNITSNTLGVLEAMARHKVKKLIYSSTCATYGEPEKMPITEDTPQVPINPYGKAKKMAEDMILDFSK-NSDMAVMILRYFNVIGSDP 279          
BLAST of DR405977 vs. ExPASy Swiss-Prot
Match: ARAE1_ORYSJ (Probable UDP-arabinose 4-epimerase 1 OS=Oryza sativa subsp. japonica GN=UEL-1 PE=2 SV=2)

HSP 1 Score: 147.132 bits (370), Expect = 8.840e-35
Identity = 76/187 (40.64%), Postives = 113/187 (60.43%), Query Frame = 3
Query:  168 NILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPLEAMNPYGRTKLFIEEICRDVHRS-DSEWKIILLRYFNPVGAHP 725
            ++LVTGGAGYIGSH  L+LL   ++  +VDNL   +  A+  ++ L    G  + F   DL D  A+  +FA+  F AV+HFA +  VGES  +PL Y+ N    T+ +LE MAAH  + L++SS+   YG P+ +P TE  P   +NPYG+ K   E+I  D  +S  ++  +++LRYFN +G+ P
Sbjct:   74 HVLVTGGAGYIGSHAALRLLKDSFRVTIVDNLSRGNMGAIKVLQNLFSEPG-RLQFIYADLGDPKAVNRIFAENAFDAVMHFAAVAYVGESTLEPLRYYHNITSNTLVVLEAMAAHNVRTLIYSSTCATYGEPEKMPITEGTPQFPINPYGKAKKMAEDIILDFSKSKKADMAVMILRYFNVIGSDP 259          
BLAST of DR405977 vs. ExPASy Swiss-Prot
Match: GALE_BACHD (UDP-glucose 4-epimerase OS=Bacillus halodurans GN=galE PE=3 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 3.359e-34
Identity = 84/188 (44.68%), Postives = 110/188 (58.51%), Query Frame = 3
Query:  171 ILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPLEAMNPYGRTKLFIEEI---CRDVHRSDSEWKIILLRYFNPVGAHP 725
            ILVTGGAGYIGSHTVL LL  G + +V+DNL      A++ V           TF+  D+RD   L+ +F       VIHFA    VGESV++P+ Y++NN+IGT TLL+ M  H  K +VFSS+A  YG P  +P  E  P    NPYG TKL IE++   C++ +      + + LRYFN  GA P
Sbjct:    3 ILVTGGAGYIGSHTVLFLLEQGEQVIVLDNLQKGHAGALSDV-----------TFYHGDIRDDQLLDTIFTTHSIDTVIHFAANSLVGESVKQPIEYYENNVIGTHTLLKKMLEHDVKKIVFSSTAATYGEPVQIPIQESDPTIPTNPYGETKLAIEKMFHWCQEAY----GLQYVCLRYFNAAGADP 175          
BLAST of DR405977 vs. ExPASy Swiss-Prot
Match: GALE_LACCA (UDP-glucose 4-epimerase OS=Lactobacillus casei GN=galE PE=3 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 4.851e-33
Identity = 85/187 (45.45%), Postives = 105/187 (56.15%), Query Frame = 3
Query:  171 ILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPLEAMNPYGRTKLFIEEICRDVHRSDSEW--KIILLRYFNPVGAHP 725
            I V GGAGYIGSHTV QLL  G   VV+DNL      AV               F++ D+RD   L  +F++ K   ++HFA    V ES++ PL YFDNN  G ITLLE M   G K +VFSS+A  YG PK VP  E  P    NPYG +KL +E+I   +H +D  +  K + LRYFN  GA P
Sbjct:    3 IAVLGGAGYIGSHTVKQLLAAGEDVVVLDNLITGHRKAV----------DPRARFYQGDIRDYHFLSQVFSQEKIDGIVHFAAFSIVPESMKDPLKYFDNNTGGMITLLEAMNQFGIKKIVFSSTAATYGEPKQVPIKETDPQVPTNPYGESKLAMEKI---MHWADVAYGLKFVALRYFNVAGAMP 176          
BLAST of DR405977 vs. ExPASy Swiss-Prot
Match: EXOB_RHIME (UDP-glucose 4-epimerase OS=Rhizobium meliloti GN=exoB PE=3 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 1.081e-32
Identity = 81/184 (44.02%), Postives = 103/184 (55.98%), Query Frame = 3
Query:  168 NILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPLEAMNPYGRTKLFIEEICRDVHRSDSEWKIILLRYFNPVGA 719
            NILV GGAGYIGSHT LQL   GY+ VV DNL N  E  V                 K D+RD+  L+ + A+ K  A++HFA +  VGESV+ P  ++DNN+IGT+TLL    A G    VFSS+   YG P  VP  E      +NPYGRTK   E+  +D +      + ++LRYFN  GA
Sbjct:    5 NILVVGGAGYIGSHTCLQLAAKGYQPVVYDNLSNGHEEFVKWG-----------VLEKGDIRDRQRLDEVLARHKPRAILHFAAMIEVGESVKDPAAFYDNNVIGTLTLLSAALAAGIDAFVFSSTCATYGLPDSVPMDESHKQAPINPYGRTKWICEQALKD-YGLYKGLRSVILRYFNAAGA 176          
The following BLAST results are available for this feature:
BLAST of DR405977 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 63
Match NameE-valueIdentityDescription
GALE_PASHA1.721e-3844.32UDP-glucose 4-epimerase OS=Pasteurella haemolytica... [more]
ARAE1_ARATH5.008e-3844.09UDP-arabinose 4-epimerase 1 OS=Arabidopsis thalian... [more]
ARAE2_ARATH1.611e-3643.55Putative UDP-arabinose 4-epimerase 2 OS=Arabidopsi... [more]
ARAE2_ORYSJ1.044e-3542.47Probable UDP-arabinose 4-epimerase 2 OS=Oryza sati... [more]
ARAE3_ORYSJ5.182e-3540.86Probable UDP-arabinose 4-epimerase 3 OS=Oryza sati... [more]
ARAE4_ARATH6.769e-3541.40Putative UDP-arabinose 4-epimerase 4 OS=Arabidopsi... [more]
ARAE1_ORYSJ8.840e-3540.64Probable UDP-arabinose 4-epimerase 1 OS=Oryza sati... [more]
GALE_BACHD3.359e-3444.68UDP-glucose 4-epimerase OS=Bacillus halodurans GN=... [more]
GALE_LACCA4.851e-3345.45UDP-glucose 4-epimerase OS=Lactobacillus casei GN=... [more]
EXOB_RHIME1.081e-3244.02UDP-glucose 4-epimerase OS=Rhizobium meliloti GN=e... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCSAJ-PNP1248F19 Mature Juice Sac from Navel Orange in pTriplEx2 vector Citrus sinensis cDNA clone CSAJ-PNP1248F19 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DR405977 ID=DR405977|Name=DR405977|organism=Citrus sinensis|type=EST|length=727bp
GGGGGTCAGTTTCATTTTTTTCTTTTCCTTTAAATTTCTCTGAGCGAGGC
CAAGCCCAAGTCTCATCACTTCCTTCGTAATTCCCCCGTTTCTTCAAATT
TTCGTGTACTTTGTGCCCTTTTTTTTGGTTCTTCTGATTGGTCTCTCCGT
TAGACTCCATGGCTAAGAACATTTTGGTGACCGGTGGCGCCGGTTACATT
GGAAGCCACACCGTGCTTCAGTTGCTGTTAGGCGGTTACAAAACTGTCGT
CGTCGACAATCTCGATAATGCCTCGGAAATCGCCGTCGCAAAAGTCAAAG
AACTCGCTGGCAATCAAGGCGACAACATGACCTTTCATAAGTTGGATCTC
CGGGACAAAGCAGCGCTGGAAGCATTGTTTGCCAAAACAAAGTTCGGTGC
TGTCATCCATTTTGCTGGACTGGAAGCAGTTGGTGAAAGTGTGCAGAAAC
CATTGCTGTATTTTGACAACAATCTTATTGGAACCATAACTCTCTTGGAA
GTTATGGCAGCACATGGCTGCAAAAATCTGGTCTTTTCATCATCAGCTAC
TGTTTATGGCTGGCCAAAGGTGGTTCCGTGTACAGAAGAGTTCCCGTTAG
AGGCAATGAACCCTTATGGACGTACCAAGCTTTTCATTGAAGAGATTTGC
CGTGATGTCCACCGCTCAGACTCTGAATGGAAGATCATATTGCTGAGATA
TTTCAATCCTGTTGGTGCACATCCAAG
back to top