DR405962

Overview
NameDR405962
Unique NameDR405962
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length729
Libraries
Library NameType
Mature Juice Sac from Navel Orange in pTriplEx2 vectorcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6306 contig Csv1_Contig6306:1..728. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: GAL10_CANMA (Bifunctional protein GAL10 (Fragment) OS=Candida maltosa GN=GAL10 PE=3 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 1.922e-29
Identity = 71/149 (47.65%), Postives = 97/149 (65.10%), Query Frame = 3
Query:  174 LVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVY------GWPKVVPCTEEFPLE 602
            LVTGGAGYIGSHTV++L+  G K V+ DNL N+S  AVA+++ +      +  F K+D+R++  L  +F+  K   VIHFA L+AVGES + PL Y+DNN+ GTI LL V  ++  K +VFSSSATVY      G   ++P  E  P+E
Sbjct:    7 LVTGGAGYIGSHTVIELINHGIKVVIADNLSNSSYDAVARIEFIVKQHVSH--FIKVDIRNEKELNQVFSNHKISGVIHFAALKAVGESTKIPLEYYDNNVSGTIALLNVCKSNNVKTIVFSSSATVYGDVTRFGDNSMIPIPEHCPME 153          
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: GALE_LACCA (UDP-glucose 4-epimerase OS=Lactobacillus casei GN=galE PE=3 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 3.279e-29
Identity = 74/159 (46.54%), Postives = 90/159 (56.60%), Query Frame = 3
Query:  171 ILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPLEAMNPYGRTKLFIEEI 647
            I V GGAGYIGSHTV QLL  G   VV+DNL      AV               F++ D+RD   L  +F++ K   ++HFA    V ES++ PL YFDNN  G ITLLE M   G K +VFSS+A  YG PK VP  E  P    NPYG +KL +E+I
Sbjct:    3 IAVLGGAGYIGSHTVKQLLAAGEDVVVLDNLITGHRKAV----------DPRARFYQGDIRDYHFLSQVFSQEKIDGIVHFAAFSIVPESMKDPLKYFDNNTGGMITLLEAMNQFGIKKIVFSSTAATYGEPKQVPIKETDPQVPTNPYGESKLAMEKI 151          
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: EXOB_RHILT (UDP-glucose 4-epimerase OS=Rhizobium leguminosarum bv. trifolii GN=exoB PE=3 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 5.594e-29
Identity = 71/164 (43.29%), Postives = 92/164 (56.10%), Query Frame = 3
Query:  165 KNILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPLEAMNPYGRTKLFIEEICRD 656
            + +LV GGAGYIGSHT L L   GY+ VV DN  N     V       G           D+RD+A L+ + AK K  A++HFA L  VGESV+ P+ +++NN+IGT+TLL    A G    VFSS+   YG P+ VP  E      +NPYGRTK  +E+   D
Sbjct:    4 ETVLVVGGAGYIGSHTCLDLANKGYRPVVFDNFSNGHREFVRWGPAEEG-----------DIRDRARLDEVLAKHKPAAILHFAALIEVGESVKDPVSFYENNVIGTLTLLSAAQAAGINAFVFSSTCATYGLPQSVPLDETHRQVPINPYGRTKYIVEQALAD 156          
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: ARAE3_ARATH (Probable UDP-arabinose 4-epimerase 3 OS=Arabidopsis thaliana GN=At4g20460 PE=2 SV=2)

HSP 1 Score: 124.405 bits (311), Expect = 6.184e-28
Identity = 66/167 (39.52%), Postives = 96/167 (57.49%), Query Frame = 3
Query:  168 NILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPLEAMNPYGRTKLFIEEICRDVHRS 668
            ++LVTGGAGYIGSH  L+LL   Y+  +VDNL   +  AV  ++ L    G  + F   DL D  A++ +F++  F AV+HFA +  VGES   PL Y+ N    T+ +LE +A H  K L++SS+   YG P  +P  E  P   +NPYG+ K   E++  D  ++
Sbjct:   71 HVLVTGGAGYIGSHAALRLLKDSYRVTIVDNLSRGNLGAVKVLQGLFPEPG-RLQFIYADLGDAKAVDKIFSENAFDAVMHFAAVAYVGESTLDPLKYYHNITSNTLVVLEAVARHKVKKLIYSSTCATYGEPDKMPIVEVTPQVPINPYGKAKKMAEDMILDFSKN 236          
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: GALE_LACHE (UDP-glucose 4-epimerase OS=Lactobacillus helveticus GN=galE PE=2 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 8.077e-28
Identity = 70/167 (41.92%), Postives = 94/167 (56.29%), Query Frame = 3
Query:  171 ILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPLEAMNPYGRTKLFIEEICRDVHRSD 671
            +LV GGAGYIGSH V +L+  G   +V+D L      AV               F++ D+ D   +  +    K  AV+HFA    V ESV+KPL Y+DNN+ G I+LL+ M     K LVFSSSA  YG PK +P TE+ PL  +NPYG TK+ +E+I     ++D
Sbjct:    3 VLVIGGAGYIGSHAVRELVKEGNDVLVLDALYTGHRKAV----------DPKAKFYQGDIEDTFLVSKILRDEKIDAVMHFAAYSLVPESVKKPLKYYDNNVTGMISLLQAMNDANVKYLVFSSSAATYGIPKKLPITEDTPLNPINPYGETKMMMEKIMAWADKAD 159          
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: GALE_STRTR (UDP-glucose 4-epimerase OS=Streptococcus thermophilus GN=galE PE=3 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 2.598e-26
Identity = 73/163 (44.79%), Postives = 94/163 (57.67%), Query Frame = 3
Query:  171 ILVTGGAGYIGSHTVLQLLLGGY-KTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTK-FGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPLEAMNPYGRTKLFIEEICR 653
            ILV GGAGYIGSH V +L+  G  K VVVD+L      AV            +  F++ DL D+  +  +F +     AVIHFA    VGES++KPL YFDNN  G + LLEVM   G K +VFSS+A  YG P+ +P  E  P   +NPYG +KL +E I +
Sbjct:    3 ILVLGGAGYIGSHMVDRLVEKGQEKVVVVDSLVTGHRAAVHP----------DAIFYQGDLSDQDFMRKVFKENPDVDAVIHFAAYSLVGESMEKPLKYFDNNTAGMVKLLEVMNECGVKYIVFSSTAATYGIPEEIPILETTPQNPINPYGESKLMMETIMK 155          
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: GALE_STRMU (UDP-glucose 4-epimerase OS=Streptococcus mutans GN=galE PE=3 SV=2)

HSP 1 Score: 117.857 bits (294), Expect = 5.788e-26
Identity = 72/163 (44.17%), Postives = 93/163 (57.06%), Query Frame = 3
Query:  171 ILVTGGAGYIGSHTVLQLL-LGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTK-FGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPLEAMNPYGRTKLFIEEICR 653
            ILV GGAGYIGSH V +L+  G  + VVVD+L      AV    +          F++ DL D+  +  +F +     AVIHFA    V ES++KPL YFDNN  G I LLEVM+  G K +VFSS+A  YG P  +P  E  P   +NPYG +KL +E I +
Sbjct:    3 ILVLGGAGYIGSHMVDRLIEKGEEEVVVVDSLVTGHRAAVHPAAK----------FYQGDLADREFMSMVFRENPDVDAVIHFAAYSLVAESMKKPLKYFDNNTAGMIKLLEVMSEFGVKYIVFSSTAATYGIPDEIPIKETTPQRPINPYGESKLMMETIMK 155          
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: GALE_CORGL (UDP-glucose 4-epimerase OS=Corynebacterium glutamicum GN=galE PE=3 SV=2)

HSP 1 Score: 117.857 bits (294), Expect = 5.788e-26
Identity = 65/158 (41.14%), Postives = 90/158 (56.96%), Query Frame = 3
Query:  171 ILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAV-AKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPLEAMNPYGRTKLFIE 641
            +LVTGGAGY+GS     LL  G+   ++DN    +  AV A  + + G+  D              +E + ++  F  V+HFA    VGESV+KP  Y+ +N++  +TLL+ M AHG  NLVFSS+A  YG P VVP TE+ P +  N YG TKL I+
Sbjct:    3 LLVTGGAGYVGSVAAAVLLEHGHDVTIIDNFSTGNREAVPADARLIEGDVND-------------VVEEVLSEGGFEGVVHFAARSLVGESVEKPNEYWHDNVVTALTLLDAMRAHGVNNLVFSSTAATYGEPDVVPITEDMPTQPTNAYGATKLSID 147          
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: GALE_CORDI (UDP-glucose 4-epimerase OS=Corynebacterium diphtheriae GN=galE PE=3 SV=2)

HSP 1 Score: 116.316 bits (290), Expect = 1.684e-25
Identity = 65/157 (41.40%), Postives = 92/157 (58.60%), Query Frame = 3
Query:  171 ILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPLEAMNPYGRTKLFIE 641
            +LVTGGAGY+GS     LL  G++  +VDNL   +  AV              TF + D++D A  + + +   F AV+HFA    VGESV+KP  Y+ +N++ T+ LL+ M  +  +N+VFSS+A  YG P+ VP TE+ P    NPYG TKL I+
Sbjct:    3 LLVTGGAGYVGSVCSTVLLEQGHEVTIVDNLTTGNRDAVPL----------GATFVEGDIKDVA--DNVLSSDSFDAVLHFAARSLVGESVEKPDEYWQHNMVTTLALLDAMKRNNVRNIVFSSTAATYGEPETVPITEDAPTHPTNPYGATKLSID 147          
BLAST of DR405962 vs. ExPASy Swiss-Prot
Match: GALE_STRLI (UDP-glucose 4-epimerase OS=Streptomyces lividans GN=galE PE=3 SV=2)

HSP 1 Score: 115.161 bits (287), Expect = 3.752e-25
Identity = 65/164 (39.63%), Postives = 89/164 (54.27%), Query Frame = 3
Query:  159 MAKNILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALF-AKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPLEAMNPYGRTKLFIEEI 647
            M+   LVTGGAGY+GS     L+  G + VV+ NL       V              +F++ D+RD+  +  +F  +  F  V+HFA    VGESV KP  Y+DNN+ GT+ LLE M   G + LVFSS+A  YG P+ VP  E  P    NPYG +KL ++ +
Sbjct:    1 MSGKYLVTGGAGYVGSVVAQHLVEAGNEVVVLHNLSTGFRAGVPA----------GASFYRGDIRDQDFMRKVFRGRLSFDGVLHFAAFSQVGESVVKPEKYWDNNVGGTMALLEAMRGAGVRRLVFSSTAATYGEPEQVPIVESAPTRPTNPYGASKLAVDHM 154          
The following BLAST results are available for this feature:
BLAST of DR405962 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 63
Match NameE-valueIdentityDescription
GAL10_CANMA1.922e-2947.65Bifunctional protein GAL10 (Fragment) OS=Candida m... [more]
GALE_LACCA3.279e-2946.54UDP-glucose 4-epimerase OS=Lactobacillus casei GN=... [more]
EXOB_RHILT5.594e-2943.29UDP-glucose 4-epimerase OS=Rhizobium leguminosarum... [more]
ARAE3_ARATH6.184e-2839.52Probable UDP-arabinose 4-epimerase 3 OS=Arabidopsi... [more]
GALE_LACHE8.077e-2841.92UDP-glucose 4-epimerase OS=Lactobacillus helveticu... [more]
GALE_STRTR2.598e-2644.79UDP-glucose 4-epimerase OS=Streptococcus thermophi... [more]
GALE_STRMU5.788e-2644.17UDP-glucose 4-epimerase OS=Streptococcus mutans GN... [more]
GALE_CORGL5.788e-2641.14UDP-glucose 4-epimerase OS=Corynebacterium glutami... [more]
GALE_CORDI1.684e-2541.40UDP-glucose 4-epimerase OS=Corynebacterium diphthe... [more]
GALE_STRLI3.752e-2539.63UDP-glucose 4-epimerase OS=Streptomyces lividans G... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCSAJ-PNP1248E24 Mature Juice Sac from Navel Orange in pTriplEx2 vector Citrus sinensis cDNA clone CSAJ-PNP1248E24 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DR405962 ID=DR405962|Name=DR405962|organism=Citrus sinensis|type=EST|length=729bp
GGGGGTCAGTTTCATTTTTTTCTTTTCCTTTAAATTTCTCTGAGCGAGGC
CAAGCCCAAGTCTCATCACTTCCTTCGTAATTCCCCCGTTTCTTCAAATT
TTCGTGTACTTTGTGCCCTTTTTTTTGGTTCTTCTGATTGGTCTCTCCGT
TAGACTCCATGGCTAAGAACATTTTGGTGACCGGTGGCGCCGGTTACATT
GGAAGCCACACCGTGCTTCAGTTGCTGTTAGGCGGTTACAAAACTGTCGT
CGTCGACAATCTCGATAATGCCTCGGAAATCGCCGTCGCAAAAGTCAAAG
AACTCGCTGGCAATCAAGGCGACAACATGACCTTTCATAAGTTGGATCTC
CGGGACAAAGCAGCGCTGGAAGCATTGTTTGCCAAAACAAAGTTCGGTGC
TGTCATCCATTTTGCTGGACTGGAAGCAGTTGGTGAAAGTGTGCAGAAAC
CATTGCTGTATTTTGACAACAATCTTATTGGAACCATAACTCTCTTGGAA
GTTATGGCAGCACATGGCTGCAAAAATCTGGTCTTTTCATCATCAGCTAC
TGTTTATGGCTGGCCAAAGGTGGTTCCGTGTACAGAAGAGTTCCCGTTAG
AGGCAATGAACCCTTATGGACGTACCAAGCTTTTCATTGAAGAGATTTGC
CGTGATGTCCACCGCTCAGACTCTGAATGGAAAGATCATATTGCTGAGAT
ATTTCAATCCTGTTGNNNNNNATCCAAGT
back to top