DR403425

Overview
NameDR403425
Unique NameDR403425
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length786
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6092 contig Csv1_Contig6092:1..786. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DR403425 vs. ExPASy Swiss-Prot
Match: RECA_SACEN (Protein recA OS=Saccharopolyspora erythraea (strain NRRL 23338) GN=recA PE=3 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 1.632e-34
Identity = 59/103 (57.28%), Postives = 79/103 (76.70%), Query Frame = 2
Query:  353 DRQRALDAAMNDINSSFGKESVTRLGSAGGALVETFPSGCLTLDLALG-GGLPKGRIVEIFGPESSGKTTLALHAIAEVQKLGGNAMLVDAEHAFDPSYSKAL 658
            D+ +AL+ A+  I+  +GK SV RLG    A +E  P+G ++LD+ALG GGLP+GRIVE++GPESSGKT++ALHA+A  QKLGG A  +DAEHA DP Y+KA+
Sbjct:    6 DKGKALELALAQIDKQYGKGSVMRLGDETRAPIEVIPTGSISLDVALGIGGLPRGRIVEVYGPESSGKTSVALHAVANAQKLGGTAAFIDAEHALDPEYAKAI 108          

HSP 2 Score: 43.5134 bits (101), Expect = 1.632e-34
Identity = 20/36 (55.56%), Postives = 26/36 (72.22%), Query Frame = 3
Query:  651 KHXGVDVENLIVRXXDNGEMALEIADRMCRSGAIDL 758
            K  GVD ++L+V   D GE ALEIAD + RSGA+D+
Sbjct:  106 KAIGVDTDSLLVSQPDTGEQALEIADMLIRSGALDI 141          
BLAST of DR403425 vs. ExPASy Swiss-Prot
Match: RECA_BIFLO (Protein recA OS=Bifidobacterium longum GN=recA PE=3 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 2.762e-34
Identity = 62/102 (60.78%), Postives = 73/102 (71.57%), Query Frame = 2
Query:  356 RQRALDAAMNDINSSFGKESVTRLGSAGGALVETFPSGCLTLDLALG-GGLPKGRIVEIFGPESSGKTTLALHAIAEVQKLGGNAMLVDAEHAFDPSYSKAL 658
            R+ ALD A+  +  SFGK S  RLG      VE  P+G L LD+ALG GGLPKGRIVEI+GPESSGKTTLALH +A  QK GG A  +DAEHA DP+Y++ L
Sbjct:   23 RKAALDTALAQVEKSFGKGSAMRLGDQPEQNVEVIPTGSLALDMALGIGGLPKGRIVEIYGPESSGKTTLALHVVANAQKKGGVAAYIDAEHALDPAYARKL 124          

HSP 2 Score: 45.4394 bits (106), Expect = 2.762e-34
Identity = 21/33 (63.64%), Postives = 26/33 (78.79%), Query Frame = 3
Query:  660 GVDVENLIVRXXDNGEMALEIADRMCRSGAIDL 758
            GVD ++LIV   DNGE ALEIAD + RSGA+D+
Sbjct:  125 GVDTDSLIVSQPDNGEQALEIADMLIRSGALDV 157          
BLAST of DR403425 vs. ExPASy Swiss-Prot
Match: RECA_RHORT (Protein recA OS=Rhodospirillum rubrum (strain ATCC 11170 / NCIB 8255) GN=recA PE=3 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 2.766e-34
Identity = 63/109 (57.80%), Postives = 81/109 (74.31%), Query Frame = 2
Query:  338 DSRFLDRQRALDAAMNDINSSFGKESVTRLGSAGGAL-VETFPSGCLTLDLALG-GGLPKGRIVEIFGPESSGKTTLALHAIAEVQKLGGNAMLVDAEHAFDPSYSKAL 658
            D   +D+Q+AL+AA+  I  +FGK S+ +LG  G  + +E+  +G L LD+ALG GGLP+GRIVEI+GPESSGKTTLALH +AE QK GG    VDAEHAFDP Y++ L
Sbjct:   10 DKDTMDKQKALEAAVGQIERAFGKGSIMKLGQRGSVVDIESISTGSLGLDIALGIGGLPRGRIVEIYGPESSGKTTLALHVVAEAQKKGGQCAFVDAEHAFDPLYARKL 118          

HSP 2 Score: 41.2022 bits (95), Expect = 2.766e-34
Identity = 19/33 (57.58%), Postives = 25/33 (75.76%), Query Frame = 3
Query:  660 GVDVENLIVRXXDNGEMALEIADRMCRSGAIDL 758
            GV +++L+V   D GE ALEIAD + RSGAID+
Sbjct:  119 GVSLDDLLVSQPDTGEQALEIADTLVRSGAIDV 151          
BLAST of DR403425 vs. ExPASy Swiss-Prot
Match: RECA_BRUSU (Protein recA OS=Brucella suis GN=recA PE=3 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 2.766e-34
Identity = 64/105 (60.95%), Postives = 79/105 (75.24%), Query Frame = 2
Query:  350 LDRQRALDAAMNDINSSFGKESVTRLGSAGGAL-VETFPSGCLTLDLALG-GGLPKGRIVEIFGPESSGKTTLALHAIAEVQKLGGNAMLVDAEHAFDPSYSKAL 658
            +D+ +ALDAA++ I  +FGK S+ RLG     + +ET  +G L+LD+ALG GGLPKGRIVEI+GPESSGKTTLALH IAE QK GG    VDAEHA DP Y++ L
Sbjct:   14 VDKTKALDAALSQIERAFGKGSIMRLGQNDQVVEIETVSTGSLSLDIALGVGGLPKGRIVEIYGPESSGKTTLALHTIAEAQKKGGICAFVDAEHALDPVYARKL 118          

HSP 2 Score: 44.669 bits (104), Expect = 2.766e-34
Identity = 20/33 (60.61%), Postives = 25/33 (75.76%), Query Frame = 3
Query:  660 GVDVENLIVRXXDNGEMALEIADRMCRSGAIDL 758
            GVD+ENL++   D GE ALEI D + RSGAID+
Sbjct:  119 GVDLENLLISQPDTGEQALEITDTLVRSGAIDV 151          
BLAST of DR403425 vs. ExPASy Swiss-Prot
Match: RECA_BRUSI (Protein recA OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=recA PE=3 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 2.766e-34
Identity = 64/105 (60.95%), Postives = 79/105 (75.24%), Query Frame = 2
Query:  350 LDRQRALDAAMNDINSSFGKESVTRLGSAGGAL-VETFPSGCLTLDLALG-GGLPKGRIVEIFGPESSGKTTLALHAIAEVQKLGGNAMLVDAEHAFDPSYSKAL 658
            +D+ +ALDAA++ I  +FGK S+ RLG     + +ET  +G L+LD+ALG GGLPKGRIVEI+GPESSGKTTLALH IAE QK GG    VDAEHA DP Y++ L
Sbjct:   14 VDKTKALDAALSQIERAFGKGSIMRLGQNDQVVEIETVSTGSLSLDIALGVGGLPKGRIVEIYGPESSGKTTLALHTIAEAQKKGGICAFVDAEHALDPVYARKL 118          

HSP 2 Score: 44.669 bits (104), Expect = 2.766e-34
Identity = 20/33 (60.61%), Postives = 25/33 (75.76%), Query Frame = 3
Query:  660 GVDVENLIVRXXDNGEMALEIADRMCRSGAIDL 758
            GVD+ENL++   D GE ALEI D + RSGAID+
Sbjct:  119 GVDLENLLISQPDTGEQALEITDTLVRSGAIDV 151          
BLAST of DR403425 vs. ExPASy Swiss-Prot
Match: RECA_BRUME (Protein recA OS=Brucella melitensis GN=recA PE=3 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 2.766e-34
Identity = 64/105 (60.95%), Postives = 79/105 (75.24%), Query Frame = 2
Query:  350 LDRQRALDAAMNDINSSFGKESVTRLGSAGGAL-VETFPSGCLTLDLALG-GGLPKGRIVEIFGPESSGKTTLALHAIAEVQKLGGNAMLVDAEHAFDPSYSKAL 658
            +D+ +ALDAA++ I  +FGK S+ RLG     + +ET  +G L+LD+ALG GGLPKGRIVEI+GPESSGKTTLALH IAE QK GG    VDAEHA DP Y++ L
Sbjct:   14 VDKTKALDAALSQIERAFGKGSIMRLGQNDQVVEIETVSTGSLSLDIALGVGGLPKGRIVEIYGPESSGKTTLALHTIAEAQKKGGICAFVDAEHALDPVYARKL 118          

HSP 2 Score: 44.669 bits (104), Expect = 2.766e-34
Identity = 20/33 (60.61%), Postives = 25/33 (75.76%), Query Frame = 3
Query:  660 GVDVENLIVRXXDNGEMALEIADRMCRSGAIDL 758
            GVD+ENL++   D GE ALEI D + RSGAID+
Sbjct:  119 GVDLENLLISQPDTGEQALEITDTLVRSGAIDV 151          
BLAST of DR403425 vs. ExPASy Swiss-Prot
Match: RECA_BRUMB (Protein recA OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=recA PE=3 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 2.766e-34
Identity = 64/105 (60.95%), Postives = 79/105 (75.24%), Query Frame = 2
Query:  350 LDRQRALDAAMNDINSSFGKESVTRLGSAGGAL-VETFPSGCLTLDLALG-GGLPKGRIVEIFGPESSGKTTLALHAIAEVQKLGGNAMLVDAEHAFDPSYSKAL 658
            +D+ +ALDAA++ I  +FGK S+ RLG     + +ET  +G L+LD+ALG GGLPKGRIVEI+GPESSGKTTLALH IAE QK GG    VDAEHA DP Y++ L
Sbjct:   14 VDKTKALDAALSQIERAFGKGSIMRLGQNDQVVEIETVSTGSLSLDIALGVGGLPKGRIVEIYGPESSGKTTLALHTIAEAQKKGGICAFVDAEHALDPVYARKL 118          

HSP 2 Score: 44.669 bits (104), Expect = 2.766e-34
Identity = 20/33 (60.61%), Postives = 25/33 (75.76%), Query Frame = 3
Query:  660 GVDVENLIVRXXDNGEMALEIADRMCRSGAIDL 758
            GVD+ENL++   D GE ALEI D + RSGAID+
Sbjct:  119 GVDLENLLISQPDTGEQALEITDTLVRSGAIDV 151          
BLAST of DR403425 vs. ExPASy Swiss-Prot
Match: RECA_BRUC2 (Protein recA OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=recA PE=3 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 2.766e-34
Identity = 64/105 (60.95%), Postives = 79/105 (75.24%), Query Frame = 2
Query:  350 LDRQRALDAAMNDINSSFGKESVTRLGSAGGAL-VETFPSGCLTLDLALG-GGLPKGRIVEIFGPESSGKTTLALHAIAEVQKLGGNAMLVDAEHAFDPSYSKAL 658
            +D+ +ALDAA++ I  +FGK S+ RLG     + +ET  +G L+LD+ALG GGLPKGRIVEI+GPESSGKTTLALH IAE QK GG    VDAEHA DP Y++ L
Sbjct:   14 VDKTKALDAALSQIERAFGKGSIMRLGQNDQVVEIETVSTGSLSLDIALGVGGLPKGRIVEIYGPESSGKTTLALHTIAEAQKKGGICAFVDAEHALDPVYARKL 118          

HSP 2 Score: 44.669 bits (104), Expect = 2.766e-34
Identity = 20/33 (60.61%), Postives = 25/33 (75.76%), Query Frame = 3
Query:  660 GVDVENLIVRXXDNGEMALEIADRMCRSGAIDL 758
            GVD+ENL++   D GE ALEI D + RSGAID+
Sbjct:  119 GVDLENLLISQPDTGEQALEITDTLVRSGAIDV 151          
BLAST of DR403425 vs. ExPASy Swiss-Prot
Match: RECA_BRUAB (Protein recA OS=Brucella abortus GN=recA PE=3 SV=2)

HSP 1 Score: 122.094 bits (305), Expect = 2.766e-34
Identity = 64/105 (60.95%), Postives = 79/105 (75.24%), Query Frame = 2
Query:  350 LDRQRALDAAMNDINSSFGKESVTRLGSAGGAL-VETFPSGCLTLDLALG-GGLPKGRIVEIFGPESSGKTTLALHAIAEVQKLGGNAMLVDAEHAFDPSYSKAL 658
            +D+ +ALDAA++ I  +FGK S+ RLG     + +ET  +G L+LD+ALG GGLPKGRIVEI+GPESSGKTTLALH IAE QK GG    VDAEHA DP Y++ L
Sbjct:   14 VDKTKALDAALSQIERAFGKGSIMRLGQNDQVVEIETVSTGSLSLDIALGVGGLPKGRIVEIYGPESSGKTTLALHTIAEAQKKGGICAFVDAEHALDPVYARKL 118          

HSP 2 Score: 44.669 bits (104), Expect = 2.766e-34
Identity = 20/33 (60.61%), Postives = 25/33 (75.76%), Query Frame = 3
Query:  660 GVDVENLIVRXXDNGEMALEIADRMCRSGAIDL 758
            GVD+ENL++   D GE ALEI D + RSGAID+
Sbjct:  119 GVDLENLLISQPDTGEQALEITDTLVRSGAIDV 151          
BLAST of DR403425 vs. ExPASy Swiss-Prot
Match: RECA_BRUA2 (Protein recA OS=Brucella abortus (strain 2308) GN=recA PE=3 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 2.766e-34
Identity = 64/105 (60.95%), Postives = 79/105 (75.24%), Query Frame = 2
Query:  350 LDRQRALDAAMNDINSSFGKESVTRLGSAGGAL-VETFPSGCLTLDLALG-GGLPKGRIVEIFGPESSGKTTLALHAIAEVQKLGGNAMLVDAEHAFDPSYSKAL 658
            +D+ +ALDAA++ I  +FGK S+ RLG     + +ET  +G L+LD+ALG GGLPKGRIVEI+GPESSGKTTLALH IAE QK GG    VDAEHA DP Y++ L
Sbjct:   14 VDKTKALDAALSQIERAFGKGSIMRLGQNDQVVEIETVSTGSLSLDIALGVGGLPKGRIVEIYGPESSGKTTLALHTIAEAQKKGGICAFVDAEHALDPVYARKL 118          

HSP 2 Score: 44.669 bits (104), Expect = 2.766e-34
Identity = 20/33 (60.61%), Postives = 25/33 (75.76%), Query Frame = 3
Query:  660 GVDVENLIVRXXDNGEMALEIADRMCRSGAIDL 758
            GVD+ENL++   D GE ALEI D + RSGAID+
Sbjct:  119 GVDLENLLISQPDTGEQALEITDTLVRSGAIDV 151          
The following BLAST results are available for this feature:
BLAST of DR403425 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
RECA_SACEN1.632e-3457.28Protein recA OS=Saccharopolyspora erythraea (strai... [more]
RECA_BIFLO2.762e-3460.78Protein recA OS=Bifidobacterium longum GN=recA PE=... [more]
RECA_RHORT2.766e-3457.80Protein recA OS=Rhodospirillum rubrum (strain ATCC... [more]
RECA_BRUSU2.766e-3460.95Protein recA OS=Brucella suis GN=recA PE=3 SV=1[more]
RECA_BRUSI2.766e-3460.95Protein recA OS=Brucella suis (strain ATCC 23445 /... [more]
RECA_BRUME2.766e-3460.95Protein recA OS=Brucella melitensis GN=recA PE=3 S... [more]
RECA_BRUMB2.766e-3460.95Protein recA OS=Brucella melitensis biotype 2 (str... [more]
RECA_BRUC22.766e-3460.95Protein recA OS=Brucella canis (strain ATCC 23365 ... [more]
RECA_BRUAB2.766e-3460.95Protein recA OS=Brucella abortus GN=recA PE=3 SV=2[more]
RECA_BRUA22.766e-3460.95Protein recA OS=Brucella abortus (strain 2308) GN=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCSAF-PNP1244P19 Flavedo Mature Citrus sinensis cDNA clone CSAF-PNP1244P19 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DR403425 ID=DR403425|Name=DR403425|organism=Citrus sinensis|type=EST|length=786bp
GGGGGACCCACTTTGCTTCTGCTTCTGCTCTCTGCTTCTGTGACTTGTGT
CTCCTCGTGTTTCGTCTATTATTTTCTTACAAATAATGGAGTCTCTCGCA
GCAGCAGCTGTGCCTCTGAAAGCAAAACTGGGTGTGTGCCATCAGCTATG
TTTCTCCCCATTCAACATGAAGACACACTTATGTCTCTTGTCAATTTCTT
CAAGTCCCCTTCATTGCCAATCTTCCCGCTCTCGGTTCTTCACAGCCTCG
TCCAAGCTGTCAGCTGCCAGAAAACGTGACAAGAAAATCAGCTGCGAATT
TGACGGAAAAGTTAATGGCTTTTCTTCCGACTCCGGAGACTCCCGCTTCC
TCGACCGGCAAAGAGCGTTGGATGCAGCAATGAATGACATAAACAGTTCA
TTTGGAAAAGAGAGTGTTACAAGATTGGGCAGTGCTGGTGGAGCCCTTGT
TGAAACCTTTCCCAGTGGTTGCTTGACGCTGGATTTGGCCTTAGGTGGTG
GGCTTCCTAAAGGGAGAATTGTGGAGATATTTGGGCCAGAAAGTAGTGGA
AAGACTACCCTTGCACTCCATGCAATTGCAGAAGTGCAGAAACTCGGAGG
CAATGCAATGCTTGTGGATGCAGAGCATGCTTTTGATCCATCATATTCAA
AAGCATTGNGGCGTGGATGTAGAGAATTTGATTGTTCGCCANNNTGATAA
CGGCGAGATGGCACTAGAAATTGCCGATCGTATGTGCAGATCTGGTGCCA
TAGATCTTTATTTGTGTTGACTCTGTATCAGCTCTC
back to top