DN617298

Overview
NameDN617298
Unique NameDN617298
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length696
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9861 contig Csv1_Contig9861:1101..1793. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB1_AVESA (Tubulin beta-1 chain (Fragment) OS=Avena sativa GN=TUBB1 PE=2 SV=1)

HSP 1 Score: 179.104 bits (453), Expect = 1.959e-44
Identity = 86/87 (98.85%), Postives = 86/87 (98.85%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVKSSVCDIPP GLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  282 WIPNNVKSSVCDIPPTGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 368          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB_HORVU (Tubulin beta chain OS=Hordeum vulgare GN=TUBB PE=2 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 2.558e-44
Identity = 85/87 (97.70%), Postives = 86/87 (98.85%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVKSSVCDIPP GLSMASTF+GNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  344 WIPNNVKSSVCDIPPTGLSMASTFVGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB6_ARATH (Tubulin beta-6 chain OS=Arabidopsis thaliana GN=TUBB6 PE=2 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 3.341e-44
Identity = 86/87 (98.85%), Postives = 86/87 (98.85%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVKSSVCDI PRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  344 WIPNNVKSSVCDIAPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB3_PEA (Tubulin beta-3 chain (Fragment) OS=Pisum sativum GN=TUBB3 PE=2 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 3.341e-44
Identity = 86/87 (98.85%), Postives = 86/87 (98.85%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVKSSVCDI PRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  335 WIPNNVKSSVCDIAPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 421          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB3_ELEIN (Tubulin beta-3 chain OS=Eleusine indica GN=TUBB3 PE=2 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 4.363e-44
Identity = 84/87 (96.55%), Postives = 87/87 (100.00%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVKSSVCDIPPRGL+M+STFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLV+EYQQYQDATA
Sbjct:  344 WIPNNVKSSVCDIPPRGLTMSSTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVAEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB2_DAUCA (Tubulin beta-2 chain OS=Daucus carota GN=TUBB2 PE=2 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 5.699e-44
Identity = 85/87 (97.70%), Postives = 86/87 (98.85%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVKSSVCDIPPRGLSM+STFIGNSTSIQEMFRRVSEQFTAMFR KAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  344 WIPNNVKSSVCDIPPRGLSMSSTFIGNSTSIQEMFRRVSEQFTAMFRPKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB7_ORYSJ (Tubulin beta-7 chain OS=Oryza sativa subsp. japonica GN=TUBB7 PE=2 SV=2)

HSP 1 Score: 177.178 bits (448), Expect = 7.443e-44
Identity = 83/87 (95.40%), Postives = 86/87 (98.85%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVKSSVCDIPPRGL MA+TF+GNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLV+EYQQYQDATA
Sbjct:  344 WIPNNVKSSVCDIPPRGLKMAATFVGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVAEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB5_WHEAT (Tubulin beta-5 chain OS=Triticum aestivum GN=TUBB5 PE=2 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 7.443e-44
Identity = 85/87 (97.70%), Postives = 86/87 (98.85%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVKSSVCDI PRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLV+EYQQYQDATA
Sbjct:  344 WIPNNVKSSVCDIAPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVAEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB5_ORYSJ (Tubulin beta-5 chain OS=Oryza sativa subsp. japonica GN=TUBB5 PE=1 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 9.721e-44
Identity = 84/87 (96.55%), Postives = 85/87 (97.70%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVKSSVCDIPP GL MASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLV+EYQQYQDATA
Sbjct:  344 WIPNNVKSSVCDIPPNGLKMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVAEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB1_MAIZE (Tubulin beta-1 chain OS=Zea mays GN=TUBB1 PE=2 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 9.721e-44
Identity = 84/87 (96.55%), Postives = 85/87 (97.70%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVKS+VCDIPP GL MASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  344 WIPNNVKSTVCDIPPHGLKMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
The following BLAST results are available for this feature:
BLAST of DN617298 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 258
Match NameE-valueIdentityDescription
TBB1_AVESA1.959e-4498.85Tubulin beta-1 chain (Fragment) OS=Avena sativa GN... [more]
TBB_HORVU2.558e-4497.70Tubulin beta chain OS=Hordeum vulgare GN=TUBB PE=2... [more]
TBB6_ARATH3.341e-4498.85Tubulin beta-6 chain OS=Arabidopsis thaliana GN=TU... [more]
TBB3_PEA3.341e-4498.85Tubulin beta-3 chain (Fragment) OS=Pisum sativum G... [more]
TBB3_ELEIN4.363e-4496.55Tubulin beta-3 chain OS=Eleusine indica GN=TUBB3 P... [more]
TBB2_DAUCA5.699e-4497.70Tubulin beta-2 chain OS=Daucus carota GN=TUBB2 PE=... [more]
TBB7_ORYSJ7.443e-4495.40Tubulin beta-7 chain OS=Oryza sativa subsp. japoni... [more]
TBB5_WHEAT7.443e-4497.70Tubulin beta-5 chain OS=Triticum aestivum GN=TUBB5... [more]
TBB5_ORYSJ9.721e-4496.55Tubulin beta-5 chain OS=Oryza sativa subsp. japoni... [more]
TBB1_MAIZE9.721e-4496.55Tubulin beta-1 chain OS=Zea mays GN=TUBB1 PE=2 SV=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS11_01A09_r Parent Washington Navel Orange Scale-Infested Rind cDNA Library UCRCS11 Citrus sinensis cDNA clone CS_WEd0001A09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DN617298 ID=DN617298|Name=DN617298|organism=Citrus sinensis|type=EST|length=696bp
TTTTTTTTTCCAAGGAAAAGAAATAGCATATCACATTATGGCATAATAGA
CAGTAACATAATAACATCATCGACCACAGAACATAAGAAGACAATGGCTA
AGGATAATAGAATACAAAAATAGATCAAATCCAGAATAGATAGCAAGGTA
AAGGTAGCACACACTACTACTTTCAAAACATGCATCCATCCTTTAATTTC
TCCATCCTCAATAGTCGATCCTCATCGATCCCATCATCCATCACTCACTT
TACTGCTACTTGATGTAAAAAACTCGAGAAAGAAAAACTATAACACATCA
TAGATCATTTTTTGCAATCCCAAGCAAGGTTGACAAAACCAGCTACACAG
ACAAATATGCATCATACACAACTTCTTCAAATATGATGCTCCAATTCTCC
CTCTTCCTCATCTTCATACTCGCCTTCCTCATCGGCGGTGGCATCCTGGT
ACTGCTGGTACTCAGACACGAGGTCATTCATATTGCTCTCAGCTTCAGTG
AACTCCATTTCATCCATCCCTTCACCAGTGTACCAGTGAAGGAAAGCCTT
TCTCCTAAACATAGCTGTGAATTGCTCACTCACTCTTCGGAACATTTCTT
GGATGGATGTTGAGTTCCCGATGAAGGTGGATGCCATGGAGAGACCTCTG
GGAGGAATGTCACAAACACTGGACTTCACATTGTTTGGAATCCACT
back to top