DN617298

Overview
NameDN617298
Unique NameDN617298
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length696
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9861 contig Csv1_Contig9861:1101..1793. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB2_CHICK (Tubulin beta-2 chain OS=Gallus gallus PE=2 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 4.084e-42
Identity = 78/87 (89.66%), Postives = 86/87 (98.85%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVK++VCDIPPRGL M++TFIGNST+IQE+F+R+SEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  344 WIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB2C_RAT (Tubulin beta-2C chain OS=Rattus norvegicus GN=Tubb2c PE=1 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 4.084e-42
Identity = 78/87 (89.66%), Postives = 86/87 (98.85%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVK++VCDIPPRGL M++TFIGNST+IQE+F+R+SEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  344 WIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB2C_MOUSE (Tubulin beta-2C chain OS=Mus musculus GN=Tubb2c PE=1 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 4.084e-42
Identity = 78/87 (89.66%), Postives = 86/87 (98.85%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVK++VCDIPPRGL M++TFIGNST+IQE+F+R+SEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  344 WIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB2C_HUMAN (Tubulin beta-2C chain OS=Homo sapiens GN=TUBB2C PE=1 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 4.084e-42
Identity = 78/87 (89.66%), Postives = 86/87 (98.85%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVK++VCDIPPRGL M++TFIGNST+IQE+F+R+SEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  344 WIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB2C_BOVIN (Tubulin beta-2C chain OS=Bos taurus GN=TUBB2C PE=2 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 4.084e-42
Identity = 78/87 (89.66%), Postives = 86/87 (98.85%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVK++VCDIPPRGL M++TFIGNST+IQE+F+R+SEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  344 WIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB2B_RAT (Tubulin beta-2B chain OS=Rattus norvegicus GN=Tubb2b PE=1 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 4.084e-42
Identity = 78/87 (89.66%), Postives = 86/87 (98.85%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVK++VCDIPPRGL M++TFIGNST+IQE+F+R+SEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  344 WIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB2B_MOUSE (Tubulin beta-2B chain OS=Mus musculus GN=Tubb2b PE=1 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 4.084e-42
Identity = 78/87 (89.66%), Postives = 86/87 (98.85%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVK++VCDIPPRGL M++TFIGNST+IQE+F+R+SEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  344 WIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB2B_HUMAN (Tubulin beta-2B chain OS=Homo sapiens GN=TUBB2B PE=1 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 4.084e-42
Identity = 78/87 (89.66%), Postives = 86/87 (98.85%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVK++VCDIPPRGL M++TFIGNST+IQE+F+R+SEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  344 WIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB2B_BOVIN (Tubulin beta-2B chain OS=Bos taurus GN=TUBB2B PE=1 SV=2)

HSP 1 Score: 171.4 bits (433), Expect = 4.084e-42
Identity = 78/87 (89.66%), Postives = 86/87 (98.85%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVK++VCDIPPRGL M++TFIGNST+IQE+F+R+SEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  344 WIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB2A_RAT (Tubulin beta-2A chain OS=Rattus norvegicus GN=Tubb2a PE=1 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 4.084e-42
Identity = 78/87 (89.66%), Postives = 86/87 (98.85%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVK++VCDIPPRGL M++TFIGNST+IQE+F+R+SEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  344 WIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
The following BLAST results are available for this feature:
BLAST of DN617298 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 258
Match NameE-valueIdentityDescription
TBB2_CHICK4.084e-4289.66Tubulin beta-2 chain OS=Gallus gallus PE=2 SV=1[more]
TBB2C_RAT4.084e-4289.66Tubulin beta-2C chain OS=Rattus norvegicus GN=Tubb... [more]
TBB2C_MOUSE4.084e-4289.66Tubulin beta-2C chain OS=Mus musculus GN=Tubb2c PE... [more]
TBB2C_HUMAN4.084e-4289.66Tubulin beta-2C chain OS=Homo sapiens GN=TUBB2C PE... [more]
TBB2C_BOVIN4.084e-4289.66Tubulin beta-2C chain OS=Bos taurus GN=TUBB2C PE=2... [more]
TBB2B_RAT4.084e-4289.66Tubulin beta-2B chain OS=Rattus norvegicus GN=Tubb... [more]
TBB2B_MOUSE4.084e-4289.66Tubulin beta-2B chain OS=Mus musculus GN=Tubb2b PE... [more]
TBB2B_HUMAN4.084e-4289.66Tubulin beta-2B chain OS=Homo sapiens GN=TUBB2B PE... [more]
TBB2B_BOVIN4.084e-4289.66Tubulin beta-2B chain OS=Bos taurus GN=TUBB2B PE=1... [more]
TBB2A_RAT4.084e-4289.66Tubulin beta-2A chain OS=Rattus norvegicus GN=Tubb... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS11_01A09_r Parent Washington Navel Orange Scale-Infested Rind cDNA Library UCRCS11 Citrus sinensis cDNA clone CS_WEd0001A09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DN617298 ID=DN617298|Name=DN617298|organism=Citrus sinensis|type=EST|length=696bp
TTTTTTTTTCCAAGGAAAAGAAATAGCATATCACATTATGGCATAATAGA
CAGTAACATAATAACATCATCGACCACAGAACATAAGAAGACAATGGCTA
AGGATAATAGAATACAAAAATAGATCAAATCCAGAATAGATAGCAAGGTA
AAGGTAGCACACACTACTACTTTCAAAACATGCATCCATCCTTTAATTTC
TCCATCCTCAATAGTCGATCCTCATCGATCCCATCATCCATCACTCACTT
TACTGCTACTTGATGTAAAAAACTCGAGAAAGAAAAACTATAACACATCA
TAGATCATTTTTTGCAATCCCAAGCAAGGTTGACAAAACCAGCTACACAG
ACAAATATGCATCATACACAACTTCTTCAAATATGATGCTCCAATTCTCC
CTCTTCCTCATCTTCATACTCGCCTTCCTCATCGGCGGTGGCATCCTGGT
ACTGCTGGTACTCAGACACGAGGTCATTCATATTGCTCTCAGCTTCAGTG
AACTCCATTTCATCCATCCCTTCACCAGTGTACCAGTGAAGGAAAGCCTT
TCTCCTAAACATAGCTGTGAATTGCTCACTCACTCTTCGGAACATTTCTT
GGATGGATGTTGAGTTCCCGATGAAGGTGGATGCCATGGAGAGACCTCTG
GGAGGAATGTCACAAACACTGGACTTCACATTGTTTGGAATCCACT
back to top