DN617298

Overview
NameDN617298
Unique NameDN617298
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length696
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9861 contig Csv1_Contig9861:1101..1793. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB2A_MOUSE (Tubulin beta-2A chain OS=Mus musculus GN=Tubb2a PE=1 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 4.084e-42
Identity = 78/87 (89.66%), Postives = 86/87 (98.85%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVK++VCDIPPRGL M++TFIGNST+IQE+F+R+SEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  344 WIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB2A_MACFA (Tubulin beta-2A chain OS=Macaca fascicularis GN=TUBB2A PE=2 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 4.084e-42
Identity = 78/87 (89.66%), Postives = 86/87 (98.85%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVK++VCDIPPRGL M++TFIGNST+IQE+F+R+SEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  344 WIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB2A_HUMAN (Tubulin beta-2A chain OS=Homo sapiens GN=TUBB2A PE=1 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 4.084e-42
Identity = 78/87 (89.66%), Postives = 86/87 (98.85%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVK++VCDIPPRGL M++TFIGNST+IQE+F+R+SEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  344 WIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB1_CHICK (Tubulin beta-1 chain OS=Gallus gallus PE=2 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 4.084e-42
Identity = 78/87 (89.66%), Postives = 86/87 (98.85%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVK++VCDIPPRGL M++TFIGNST+IQE+F+R+SEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  344 WIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB_EUGGR (Tubulin beta chain OS=Euglena gracilis GN=TUBB PE=2 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 5.334e-42
Identity = 78/86 (90.70%), Postives = 85/86 (98.84%), Query Frame = -3
Query:  437 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 694
            WIPNN+KSSVCDIPP+GL M++TFIGN+T+IQEMF+RVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT
Sbjct:  341 WIPNNIKSSVCDIPPKGLKMSATFIGNNTAIQEMFKRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 426          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB1_PHYPO (Tubulin beta-1 chain OS=Physarum polycephalum GN=BETA PE=1 SV=4)

HSP 1 Score: 171.014 bits (432), Expect = 5.334e-42
Identity = 79/86 (91.86%), Postives = 84/86 (97.67%), Query Frame = -3
Query:  437 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 694
            WIPNN+KSSVCDIPP+GL MA TFIGNST+IQE+F+RVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT
Sbjct:  344 WIPNNIKSSVCDIPPKGLKMAVTFIGNSTAIQELFKRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 429          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB_PHYCI (Tubulin beta chain OS=Phytophthora cinnamomi PE=3 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 6.966e-42
Identity = 78/87 (89.66%), Postives = 85/87 (97.70%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNN+K+SVCDIPP+GL M++TFIGNST+IQEMF+RVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQD TA
Sbjct:  344 WIPNNIKASVCDIPPQGLKMSTTFIGNSTAIQEMFKRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDGTA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB_TOXGO (Tubulin beta chain OS=Toxoplasma gondii PE=3 SV=1)

HSP 1 Score: 170.244 bits (430), Expect = 9.098e-42
Identity = 78/87 (89.66%), Postives = 85/87 (97.70%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNN+KSSVCDIPP+GL M+ TF+GNST+IQEMF+RVS+QFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  344 WIPNNMKSSVCDIPPKGLKMSVTFVGNSTAIQEMFKRVSDQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB2_HOMAM (Tubulin beta-2 chain OS=Homarus americanus PE=2 SV=1)

HSP 1 Score: 170.244 bits (430), Expect = 9.098e-42
Identity = 78/87 (89.66%), Postives = 86/87 (98.85%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVK++VCDIPPRGL M++TFIGNST+IQE+F+RVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ+ATA
Sbjct:  349 WIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEATA 435          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB2_CAEEL (Tubulin beta-2 chain OS=Caenorhabditis elegans GN=tbb-2 PE=2 SV=1)

HSP 1 Score: 170.244 bits (430), Expect = 9.098e-42
Identity = 76/87 (87.36%), Postives = 86/87 (98.85%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVK++VCDIPPRGL MA+TF+GNST+IQE+F+R+SEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDL+SEYQQYQ+ATA
Sbjct:  344 WIPNNVKTAVCDIPPRGLKMAATFVGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLISEYQQYQEATA 430          
The following BLAST results are available for this feature:
BLAST of DN617298 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 258
Match NameE-valueIdentityDescription
TBB2A_MOUSE4.084e-4289.66Tubulin beta-2A chain OS=Mus musculus GN=Tubb2a PE... [more]
TBB2A_MACFA4.084e-4289.66Tubulin beta-2A chain OS=Macaca fascicularis GN=TU... [more]
TBB2A_HUMAN4.084e-4289.66Tubulin beta-2A chain OS=Homo sapiens GN=TUBB2A PE... [more]
TBB1_CHICK4.084e-4289.66Tubulin beta-1 chain OS=Gallus gallus PE=2 SV=1[more]
TBB_EUGGR5.334e-4290.70Tubulin beta chain OS=Euglena gracilis GN=TUBB PE=... [more]
TBB1_PHYPO5.334e-4291.86Tubulin beta-1 chain OS=Physarum polycephalum GN=B... [more]
TBB_PHYCI6.966e-4289.66Tubulin beta chain OS=Phytophthora cinnamomi PE=3 ... [more]
TBB_TOXGO9.098e-4289.66Tubulin beta chain OS=Toxoplasma gondii PE=3 SV=1[more]
TBB2_HOMAM9.098e-4289.66Tubulin beta-2 chain OS=Homarus americanus PE=2 SV... [more]
TBB2_CAEEL9.098e-4287.36Tubulin beta-2 chain OS=Caenorhabditis elegans GN=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS11_01A09_r Parent Washington Navel Orange Scale-Infested Rind cDNA Library UCRCS11 Citrus sinensis cDNA clone CS_WEd0001A09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DN617298 ID=DN617298|Name=DN617298|organism=Citrus sinensis|type=EST|length=696bp
TTTTTTTTTCCAAGGAAAAGAAATAGCATATCACATTATGGCATAATAGA
CAGTAACATAATAACATCATCGACCACAGAACATAAGAAGACAATGGCTA
AGGATAATAGAATACAAAAATAGATCAAATCCAGAATAGATAGCAAGGTA
AAGGTAGCACACACTACTACTTTCAAAACATGCATCCATCCTTTAATTTC
TCCATCCTCAATAGTCGATCCTCATCGATCCCATCATCCATCACTCACTT
TACTGCTACTTGATGTAAAAAACTCGAGAAAGAAAAACTATAACACATCA
TAGATCATTTTTTGCAATCCCAAGCAAGGTTGACAAAACCAGCTACACAG
ACAAATATGCATCATACACAACTTCTTCAAATATGATGCTCCAATTCTCC
CTCTTCCTCATCTTCATACTCGCCTTCCTCATCGGCGGTGGCATCCTGGT
ACTGCTGGTACTCAGACACGAGGTCATTCATATTGCTCTCAGCTTCAGTG
AACTCCATTTCATCCATCCCTTCACCAGTGTACCAGTGAAGGAAAGCCTT
TCTCCTAAACATAGCTGTGAATTGCTCACTCACTCTTCGGAACATTTCTT
GGATGGATGTTGAGTTCCCGATGAAGGTGGATGCCATGGAGAGACCTCTG
GGAGGAATGTCACAAACACTGGACTTCACATTGTTTGGAATCCACT
back to top