DN617298

Overview
NameDN617298
Unique NameDN617298
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length696
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9861 contig Csv1_Contig9861:1101..1793. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB1_BRUPA (Tubulin beta-1 chain OS=Brugia pahangi PE=3 SV=1)

HSP 1 Score: 170.244 bits (430), Expect = 9.098e-42
Identity = 77/87 (88.51%), Postives = 86/87 (98.85%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVK++VCDIPPRGL M++TFIGN+T+IQE+F+R+SEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  344 WIPNNVKTAVCDIPPRGLKMSATFIGNTTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB8_PANTR (Tubulin beta-8 chain OS=Pan troglodytes GN=TUBB8 PE=3 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 1.188e-41
Identity = 77/87 (88.51%), Postives = 86/87 (98.85%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            W+PNNVK++VCDIPPRGL M++TFIGN+T+IQE+F+RVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  344 WLPNNVKTAVCDIPPRGLKMSATFIGNNTAIQELFKRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB8_HUMAN (Tubulin beta-8 chain OS=Homo sapiens GN=TUBB8 PE=1 SV=2)

HSP 1 Score: 169.859 bits (429), Expect = 1.188e-41
Identity = 77/87 (88.51%), Postives = 86/87 (98.85%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            W+PNNVK++VCDIPPRGL M++TFIGN+T+IQE+F+RVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  344 WLPNNVKTAVCDIPPRGLKMSATFIGNNTAIQELFKRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB1_MANSE (Tubulin beta-1 chain OS=Manduca sexta PE=2 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 1.188e-41
Identity = 77/87 (88.51%), Postives = 86/87 (98.85%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVK++VCDIPPRGL M++TFIGNST+IQE+F+R+SEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ+ATA
Sbjct:  344 WIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB1_GLOMM (Tubulin beta-1 chain OS=Glossina morsitans morsitans PE=2 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 1.188e-41
Identity = 77/87 (88.51%), Postives = 86/87 (98.85%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVK++VCDIPPRGL M++TFIGNST+IQE+F+R+SEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ+ATA
Sbjct:  344 WIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB1_DROME (Tubulin beta-1 chain OS=Drosophila melanogaster GN=betaTub56D PE=1 SV=2)

HSP 1 Score: 169.859 bits (429), Expect = 1.188e-41
Identity = 77/87 (88.51%), Postives = 86/87 (98.85%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVK++VCDIPPRGL M++TFIGNST+IQE+F+R+SEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ+ATA
Sbjct:  344 WIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB6_HUMAN (Tubulin beta-6 chain OS=Homo sapiens GN=TUBB6 PE=1 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 1.552e-41
Identity = 78/87 (89.66%), Postives = 85/87 (97.70%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVK +VCDIPPRGL MASTFIGNST+IQE+F+R+SEQF+AMFRRKAFLHW+TGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  344 WIPNNVKVAVCDIPPRGLKMASTFIGNSTAIQELFKRISEQFSAMFRRKAFLHWFTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB4_CAEEL (Tubulin beta-4 chain OS=Caenorhabditis elegans GN=tbb-4 PE=2 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 1.552e-41
Identity = 76/87 (87.36%), Postives = 86/87 (98.85%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVK++VCDIPPRG+ MA+TF+GNST+IQE+F+R+SEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ+ATA
Sbjct:  344 WIPNNVKTAVCDIPPRGVKMAATFVGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB2_OOMCK (Tubulin beta-2 chain (Fragment) OS=Oomycete-like sp. (strain MacKay2000) GN=TUBB2 PE=2 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 1.552e-41
Identity = 77/87 (88.51%), Postives = 84/87 (96.55%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNN+KSSVCDIPP+GL M++ FIGNST+IQEMF+R+ EQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  319 WIPNNIKSSVCDIPPKGLKMSACFIGNSTAIQEMFKRIGEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 405          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB2_ANEPH (Tubulin beta-2 chain (Fragment) OS=Anemia phyllitidis GN=TUBB2 PE=2 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 1.552e-41
Identity = 81/87 (93.10%), Postives = 82/87 (94.25%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVKSSVCDIPP GL MA TFIGNSTSIQEMFRRV +QFTAMFR KAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  312 WIPNNVKSSVCDIPPVGLKMACTFIGNSTSIQEMFRRVRDQFTAMFRXKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 398          
The following BLAST results are available for this feature:
BLAST of DN617298 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 258
Match NameE-valueIdentityDescription
TBB1_BRUPA9.098e-4288.51Tubulin beta-1 chain OS=Brugia pahangi PE=3 SV=1[more]
TBB8_PANTR1.188e-4188.51Tubulin beta-8 chain OS=Pan troglodytes GN=TUBB8 P... [more]
TBB8_HUMAN1.188e-4188.51Tubulin beta-8 chain OS=Homo sapiens GN=TUBB8 PE=1... [more]
TBB1_MANSE1.188e-4188.51Tubulin beta-1 chain OS=Manduca sexta PE=2 SV=1[more]
TBB1_GLOMM1.188e-4188.51Tubulin beta-1 chain OS=Glossina morsitans morsita... [more]
TBB1_DROME1.188e-4188.51Tubulin beta-1 chain OS=Drosophila melanogaster GN... [more]
TBB6_HUMAN1.552e-4189.66Tubulin beta-6 chain OS=Homo sapiens GN=TUBB6 PE=1... [more]
TBB4_CAEEL1.552e-4187.36Tubulin beta-4 chain OS=Caenorhabditis elegans GN=... [more]
TBB2_OOMCK1.552e-4188.51Tubulin beta-2 chain (Fragment) OS=Oomycete-like s... [more]
TBB2_ANEPH1.552e-4193.10Tubulin beta-2 chain (Fragment) OS=Anemia phylliti... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS11_01A09_r Parent Washington Navel Orange Scale-Infested Rind cDNA Library UCRCS11 Citrus sinensis cDNA clone CS_WEd0001A09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DN617298 ID=DN617298|Name=DN617298|organism=Citrus sinensis|type=EST|length=696bp
TTTTTTTTTCCAAGGAAAAGAAATAGCATATCACATTATGGCATAATAGA
CAGTAACATAATAACATCATCGACCACAGAACATAAGAAGACAATGGCTA
AGGATAATAGAATACAAAAATAGATCAAATCCAGAATAGATAGCAAGGTA
AAGGTAGCACACACTACTACTTTCAAAACATGCATCCATCCTTTAATTTC
TCCATCCTCAATAGTCGATCCTCATCGATCCCATCATCCATCACTCACTT
TACTGCTACTTGATGTAAAAAACTCGAGAAAGAAAAACTATAACACATCA
TAGATCATTTTTTGCAATCCCAAGCAAGGTTGACAAAACCAGCTACACAG
ACAAATATGCATCATACACAACTTCTTCAAATATGATGCTCCAATTCTCC
CTCTTCCTCATCTTCATACTCGCCTTCCTCATCGGCGGTGGCATCCTGGT
ACTGCTGGTACTCAGACACGAGGTCATTCATATTGCTCTCAGCTTCAGTG
AACTCCATTTCATCCATCCCTTCACCAGTGTACCAGTGAAGGAAAGCCTT
TCTCCTAAACATAGCTGTGAATTGCTCACTCACTCTTCGGAACATTTCTT
GGATGGATGTTGAGTTCCCGATGAAGGTGGATGCCATGGAGAGACCTCTG
GGAGGAATGTCACAAACACTGGACTTCACATTGTTTGGAATCCACT
back to top