DN617298

Overview
NameDN617298
Unique NameDN617298
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length696
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9861 contig Csv1_Contig9861:1101..1793. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB1_HOMAM (Tubulin beta-1 chain OS=Homarus americanus PE=2 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 3.457e-41
Identity = 77/87 (88.51%), Postives = 84/87 (96.55%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVK++VCDIPPRG+ MASTFIGNST+I E+F+RV EQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ+ATA
Sbjct:  348 WIPNNVKTAVCDIPPRGIKMASTFIGNSTAIHELFKRVGEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEATA 434          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB_TRYBR (Tubulin beta chain OS=Trypanosoma brucei rhodesiense PE=3 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 4.515e-41
Identity = 78/86 (90.70%), Postives = 81/86 (94.19%), Query Frame = -3
Query:  437 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 694
            WIPNN+KSSVCDIPP+GL MA TFIGN+T IQEMFRRV EQFT MFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT
Sbjct:  344 WIPNNIKSSVCDIPPKGLKMAVTFIGNNTCIQEMFRRVGEQFTLMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 429          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB8_PAPHA (Tubulin beta-8 chain OS=Papio hamadryas GN=TUBB8 PE=3 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 4.515e-41
Identity = 76/87 (87.36%), Postives = 86/87 (98.85%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            W+P+NVK++VCDIPPRGL M++TFIGN+T+IQE+F+RVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  344 WLPHNVKTAVCDIPPRGLKMSATFIGNNTAIQELFKRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB6_MOUSE (Tubulin beta-6 chain OS=Mus musculus GN=Tubb6 PE=1 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 4.515e-41
Identity = 77/86 (89.53%), Postives = 84/86 (97.67%), Query Frame = -3
Query:  437 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 694
            WIPNNVK +VCDIPPRGL MASTFIGNST+IQE+F+R+SEQF+AMFRRKAFLHW+TGEGMDEMEFTEAESNMNDLVSEYQQYQDAT
Sbjct:  344 WIPNNVKVAVCDIPPRGLKMASTFIGNSTAIQELFKRISEQFSAMFRRKAFLHWFTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 429          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB5_CHICK (Tubulin beta-5 chain OS=Gallus gallus PE=3 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 4.515e-41
Identity = 77/87 (88.51%), Postives = 85/87 (97.70%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVK +VCDIPPRGL MASTFIGNST+IQE+F+R+SEQF+AMFRRKAFLHW+TGEGMDEMEFTEAESNMNDLVSEYQQYQ+ATA
Sbjct:  344 WIPNNVKVAVCDIPPRGLKMASTFIGNSTAIQELFKRISEQFSAMFRRKAFLHWFTGEGMDEMEFTEAESNMNDLVSEYQQYQEATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB1_CAEEL (Tubulin beta-1 chain OS=Caenorhabditis elegans GN=mec-7 PE=2 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 4.515e-41
Identity = 76/87 (87.36%), Postives = 85/87 (97.70%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVK++VCDIPPRGL M++TFIGNST+IQE+F+R+SEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ+A A
Sbjct:  344 WIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEAAA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB1_CAEBR (Tubulin beta-1 chain OS=Caenorhabditis briggsae GN=mec-7 PE=2 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 4.515e-41
Identity = 76/87 (87.36%), Postives = 85/87 (97.70%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVK++VCDIPPRGL M++TFIGNST+IQE+F+R+SEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ+A A
Sbjct:  344 WIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEAAA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB_PLAFA (Tubulin beta chain OS=Plasmodium falciparum PE=3 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 5.897e-41
Identity = 78/87 (89.66%), Postives = 83/87 (95.40%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIP+N KSSVCDIPP GL MA TF+GNST+IQEMF+RVS+QFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  344 WIPHNTKSSVCDIPPLGLKMAVTFVGNSTAIQEMFKRVSDQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB6_BOVIN (Tubulin beta-6 chain OS=Bos taurus GN=TUBB6 PE=2 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 7.702e-41
Identity = 76/87 (87.36%), Postives = 85/87 (97.70%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVK +VCDIPPRGL M++TFIGNST+IQE+F+R+SEQF+AMFRRKAFLHW+TGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  344 WIPNNVKVAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFSAMFRRKAFLHWFTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB3_DROME (Tubulin beta-3 chain OS=Drosophila melanogaster GN=betaTub60D PE=1 SV=2)

HSP 1 Score: 167.162 bits (422), Expect = 7.702e-41
Identity = 75/87 (86.21%), Postives = 86/87 (98.85%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVK++VCDIPP+GL M+STFIGN+T+IQE+F+R+SEQF+AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ+ATA
Sbjct:  350 WIPNNVKTAVCDIPPKGLKMSSTFIGNTTAIQELFKRISEQFSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEATA 436          
The following BLAST results are available for this feature:
BLAST of DN617298 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 258
Match NameE-valueIdentityDescription
TBB1_HOMAM3.457e-4188.51Tubulin beta-1 chain OS=Homarus americanus PE=2 SV... [more]
TBB_TRYBR4.515e-4190.70Tubulin beta chain OS=Trypanosoma brucei rhodesien... [more]
TBB8_PAPHA4.515e-4187.36Tubulin beta-8 chain OS=Papio hamadryas GN=TUBB8 P... [more]
TBB6_MOUSE4.515e-4189.53Tubulin beta-6 chain OS=Mus musculus GN=Tubb6 PE=1... [more]
TBB5_CHICK4.515e-4188.51Tubulin beta-5 chain OS=Gallus gallus PE=3 SV=1[more]
TBB1_CAEEL4.515e-4187.36Tubulin beta-1 chain OS=Caenorhabditis elegans GN=... [more]
TBB1_CAEBR4.515e-4187.36Tubulin beta-1 chain OS=Caenorhabditis briggsae GN... [more]
TBB_PLAFA5.897e-4189.66Tubulin beta chain OS=Plasmodium falciparum PE=3 S... [more]
TBB6_BOVIN7.702e-4187.36Tubulin beta-6 chain OS=Bos taurus GN=TUBB6 PE=2 S... [more]
TBB3_DROME7.702e-4186.21Tubulin beta-3 chain OS=Drosophila melanogaster GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS11_01A09_r Parent Washington Navel Orange Scale-Infested Rind cDNA Library UCRCS11 Citrus sinensis cDNA clone CS_WEd0001A09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DN617298 ID=DN617298|Name=DN617298|organism=Citrus sinensis|type=EST|length=696bp
TTTTTTTTTCCAAGGAAAAGAAATAGCATATCACATTATGGCATAATAGA
CAGTAACATAATAACATCATCGACCACAGAACATAAGAAGACAATGGCTA
AGGATAATAGAATACAAAAATAGATCAAATCCAGAATAGATAGCAAGGTA
AAGGTAGCACACACTACTACTTTCAAAACATGCATCCATCCTTTAATTTC
TCCATCCTCAATAGTCGATCCTCATCGATCCCATCATCCATCACTCACTT
TACTGCTACTTGATGTAAAAAACTCGAGAAAGAAAAACTATAACACATCA
TAGATCATTTTTTGCAATCCCAAGCAAGGTTGACAAAACCAGCTACACAG
ACAAATATGCATCATACACAACTTCTTCAAATATGATGCTCCAATTCTCC
CTCTTCCTCATCTTCATACTCGCCTTCCTCATCGGCGGTGGCATCCTGGT
ACTGCTGGTACTCAGACACGAGGTCATTCATATTGCTCTCAGCTTCAGTG
AACTCCATTTCATCCATCCCTTCACCAGTGTACCAGTGAAGGAAAGCCTT
TCTCCTAAACATAGCTGTGAATTGCTCACTCACTCTTCGGAACATTTCTT
GGATGGATGTTGAGTTCCCGATGAAGGTGGATGCCATGGAGAGACCTCTG
GGAGGAATGTCACAAACACTGGACTTCACATTGTTTGGAATCCACT
back to top