DN617298

Overview
NameDN617298
Unique NameDN617298
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length696
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9861 contig Csv1_Contig9861:1101..1793. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB_METAN (Tubulin beta chain OS=Metarhizium anisopliae PE=3 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 1.453e-39
Identity = 74/85 (87.06%), Postives = 82/85 (96.47%), Query Frame = -3
Query:  440 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA 694
            WIPNN+++++C IPPRGL M+STFIGNSTSIQE+F+RV EQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Sbjct:  344 WIPNNIQTALCAIPPRGLKMSSTFIGNSTSIQELFKRVGEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA 428          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB_GIALA (Tubulin beta chain OS=Giardia lamblia PE=2 SV=3)

HSP 1 Score: 162.925 bits (411), Expect = 1.453e-39
Identity = 75/85 (88.24%), Postives = 81/85 (95.29%), Query Frame = -3
Query:  440 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA 694
            WIPNN+K SVCDIPPRGL MA+TFIGNST IQE+F+RV EQF+AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ+A
Sbjct:  344 WIPNNMKVSVCDIPPRGLKMAATFIGNSTCIQELFKRVGEQFSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEA 428          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB_EPITY (Tubulin beta chain OS=Epichloe typhina GN=TUBB PE=3 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 1.453e-39
Identity = 74/85 (87.06%), Postives = 82/85 (96.47%), Query Frame = -3
Query:  440 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA 694
            WIPNN+++++C IPPRGL M+STFIGNSTSIQE+F+RV EQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Sbjct:  344 WIPNNIQTALCAIPPRGLKMSSTFIGNSTSIQELFKRVGEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA 428          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB_BOTFU (Tubulin beta chain OS=Botryotinia fuckeliana GN=tubA PE=3 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 1.453e-39
Identity = 73/86 (84.88%), Postives = 83/86 (96.51%), Query Frame = -3
Query:  437 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 694
            WIPNNV++++C IPPRGL M+STF+GNSTSIQE+F+RV +QFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA+
Sbjct:  344 WIPNNVQTALCSIPPRGLKMSSTFVGNSTSIQELFKRVGDQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAS 429          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB_ASPPA (Tubulin beta chain OS=Aspergillus parasiticus GN=benR PE=3 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 1.453e-39
Identity = 73/86 (84.88%), Postives = 83/86 (96.51%), Query Frame = -3
Query:  437 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 694
            WIPNN+++++C IPPRGL M+STFIGNSTSIQE+F+RV +QFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA+
Sbjct:  344 WIPNNIQTALCSIPPRGLKMSSTFIGNSTSIQELFKRVGDQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAS 429          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB_ASPOR (Tubulin beta chain OS=Aspergillus oryzae GN=benA56 PE=3 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 1.453e-39
Identity = 73/86 (84.88%), Postives = 83/86 (96.51%), Query Frame = -3
Query:  437 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 694
            WIPNN+++++C IPPRGL M+STFIGNSTSIQE+F+RV +QFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA+
Sbjct:  344 WIPNNIQTALCSIPPRGLKMSSTFIGNSTSIQELFKRVGDQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAS 429          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB_ASPFL (Tubulin beta chain OS=Aspergillus flavus PE=3 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 1.453e-39
Identity = 73/86 (84.88%), Postives = 83/86 (96.51%), Query Frame = -3
Query:  437 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 694
            WIPNN+++++C IPPRGL M+STFIGNSTSIQE+F+RV +QFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA+
Sbjct:  344 WIPNNIQTALCSIPPRGLKMSSTFIGNSTSIQELFKRVGDQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAS 429          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB1_EMENI (Tubulin beta-1 chain OS=Emericella nidulans GN=benA PE=3 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 1.453e-39
Identity = 73/86 (84.88%), Postives = 83/86 (96.51%), Query Frame = -3
Query:  437 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 694
            WIPNN+++++C IPPRGL M+STFIGNSTSIQE+F+RV +QFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA+
Sbjct:  344 WIPNNIQTALCSIPPRGLKMSSTFIGNSTSIQELFKRVGDQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAS 429          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB_PESMI (Tubulin beta chain OS=Pestalotiopsis microspora GN=TUBB PE=2 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 2.478e-39
Identity = 72/85 (84.71%), Postives = 82/85 (96.47%), Query Frame = -3
Query:  440 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA 694
            WIPNNV++++C IPPRGL M+STF+GNST+IQE+F+R+ EQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Sbjct:  344 WIPNNVQTALCSIPPRGLKMSSTFVGNSTAIQELFKRIGEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA 428          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB_NEUCR (Tubulin beta chain OS=Neurospora crassa GN=tub-2 PE=1 SV=2)

HSP 1 Score: 162.155 bits (409), Expect = 2.478e-39
Identity = 72/85 (84.71%), Postives = 82/85 (96.47%), Query Frame = -3
Query:  440 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA 694
            WIPNNV++++C IPPRGL M+STF+GNST+IQE+F+R+ EQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Sbjct:  344 WIPNNVQTALCSIPPRGLKMSSTFVGNSTAIQELFKRIGEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA 428          
The following BLAST results are available for this feature:
BLAST of DN617298 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 258
Match NameE-valueIdentityDescription
TBB_METAN1.453e-3987.06Tubulin beta chain OS=Metarhizium anisopliae PE=3 ... [more]
TBB_GIALA1.453e-3988.24Tubulin beta chain OS=Giardia lamblia PE=2 SV=3[more]
TBB_EPITY1.453e-3987.06Tubulin beta chain OS=Epichloe typhina GN=TUBB PE=... [more]
TBB_BOTFU1.453e-3984.88Tubulin beta chain OS=Botryotinia fuckeliana GN=tu... [more]
TBB_ASPPA1.453e-3984.88Tubulin beta chain OS=Aspergillus parasiticus GN=b... [more]
TBB_ASPOR1.453e-3984.88Tubulin beta chain OS=Aspergillus oryzae GN=benA56... [more]
TBB_ASPFL1.453e-3984.88Tubulin beta chain OS=Aspergillus flavus PE=3 SV=1[more]
TBB1_EMENI1.453e-3984.88Tubulin beta-1 chain OS=Emericella nidulans GN=ben... [more]
TBB_PESMI2.478e-3984.71Tubulin beta chain OS=Pestalotiopsis microspora GN... [more]
TBB_NEUCR2.478e-3984.71Tubulin beta chain OS=Neurospora crassa GN=tub-2 P... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS11_01A09_r Parent Washington Navel Orange Scale-Infested Rind cDNA Library UCRCS11 Citrus sinensis cDNA clone CS_WEd0001A09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DN617298 ID=DN617298|Name=DN617298|organism=Citrus sinensis|type=EST|length=696bp
TTTTTTTTTCCAAGGAAAAGAAATAGCATATCACATTATGGCATAATAGA
CAGTAACATAATAACATCATCGACCACAGAACATAAGAAGACAATGGCTA
AGGATAATAGAATACAAAAATAGATCAAATCCAGAATAGATAGCAAGGTA
AAGGTAGCACACACTACTACTTTCAAAACATGCATCCATCCTTTAATTTC
TCCATCCTCAATAGTCGATCCTCATCGATCCCATCATCCATCACTCACTT
TACTGCTACTTGATGTAAAAAACTCGAGAAAGAAAAACTATAACACATCA
TAGATCATTTTTTGCAATCCCAAGCAAGGTTGACAAAACCAGCTACACAG
ACAAATATGCATCATACACAACTTCTTCAAATATGATGCTCCAATTCTCC
CTCTTCCTCATCTTCATACTCGCCTTCCTCATCGGCGGTGGCATCCTGGT
ACTGCTGGTACTCAGACACGAGGTCATTCATATTGCTCTCAGCTTCAGTG
AACTCCATTTCATCCATCCCTTCACCAGTGTACCAGTGAAGGAAAGCCTT
TCTCCTAAACATAGCTGTGAATTGCTCACTCACTCTTCGGAACATTTCTT
GGATGGATGTTGAGTTCCCGATGAAGGTGGATGCCATGGAGAGACCTCTG
GGAGGAATGTCACAAACACTGGACTTCACATTGTTTGGAATCCACT
back to top