DN617298

Overview
NameDN617298
Unique NameDN617298
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length696
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9861 contig Csv1_Contig9861:1101..1793. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB_CEPAC (Tubulin beta chain OS=Cephalosporium acremonium GN=TUB2 PE=3 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 3.236e-39
Identity = 73/85 (85.88%), Postives = 82/85 (96.47%), Query Frame = -3
Query:  440 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA 694
            WIPNN+++++C IPPRGL M+STFIGNSTSIQE+F+RV +QFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Sbjct:  344 WIPNNIQTALCAIPPRGLKMSSTFIGNSTSIQELFKRVGDQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA 428          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB6_CHICK (Tubulin beta-6 chain OS=Gallus gallus PE=1 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 3.236e-39
Identity = 75/87 (86.21%), Postives = 82/87 (94.25%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVK +VCDIPPRGL MA+TFIGN+T+IQE+F RVSEQF+AMFRRKAFLHWYTGEGMDEMEF+EAE N NDLVSEYQQYQDATA
Sbjct:  344 WIPNNVKVAVCDIPPRGLKMAATFIGNNTAIQELFIRVSEQFSAMFRRKAFLHWYTGEGMDEMEFSEAEGNTNDLVSEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB_VENIN (Tubulin beta chain OS=Venturia inaequalis PE=3 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 4.226e-39
Identity = 72/86 (83.72%), Postives = 83/86 (96.51%), Query Frame = -3
Query:  437 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 694
            WIPNNV++++C IPPRGL M+STF+GNSTSIQE+F+RV +QFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ+A+
Sbjct:  344 WIPNNVQTALCSIPPRGLKMSSTFVGNSTSIQELFKRVGDQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEAS 429          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB_MYCPJ (Tubulin beta chain OS=Mycosphaerella pini GN=TUB1 PE=3 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 4.226e-39
Identity = 72/86 (83.72%), Postives = 83/86 (96.51%), Query Frame = -3
Query:  437 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 694
            WIPNNV++++C IPPRGL M+STF+GNSTSIQE+F+RV +QFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ+A+
Sbjct:  344 WIPNNVQTALCSIPPRGLKMSSTFVGNSTSIQELFKRVGDQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEAS 429          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB_ERYGR (Tubulin beta chain OS=Erysiphe graminis subsp. hordei GN=TUB2 PE=3 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 4.226e-39
Identity = 72/86 (83.72%), Postives = 83/86 (96.51%), Query Frame = -3
Query:  437 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 694
            WIPNNV++++C IPPRGL M+STF+GNSTSIQE+F+RV +QFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ+A+
Sbjct:  344 WIPNNVQTALCSIPPRGLKMSSTFVGNSTSIQELFKRVGDQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEAS 429          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB_COCHE (Tubulin beta chain OS=Cochliobolus heterostrophus GN=TUB1 PE=3 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 4.226e-39
Identity = 72/86 (83.72%), Postives = 83/86 (96.51%), Query Frame = -3
Query:  437 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 694
            WIPNNV++++C IPPRGL M+STF+GNSTSIQE+F+RV +QFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ+A+
Sbjct:  344 WIPNNVQTALCSIPPRGLKMSSTFVGNSTSIQELFKRVGDQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEAS 429          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB_CERBT (Tubulin beta chain OS=Cercospora beticola GN=TUB1 PE=3 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 4.226e-39
Identity = 72/86 (83.72%), Postives = 83/86 (96.51%), Query Frame = -3
Query:  437 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 694
            WIPNNV++++C IPPRGL M+STF+GNSTSIQE+F+RV +QFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ+A+
Sbjct:  344 WIPNNVQTALCSIPPRGLKMSSTFVGNSTSIQELFKRVGDQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEAS 429          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB2_COLGL (Tubulin beta-2 chain OS=Colletotrichum gloeosporioides GN=TUB2 PE=3 SV=2)

HSP 1 Score: 161.384 bits (407), Expect = 4.226e-39
Identity = 72/85 (84.71%), Postives = 82/85 (96.47%), Query Frame = -3
Query:  440 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA 694
            WIPNNV++++C IPPRGL M+STF+GN+T+IQE+F+RV EQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Sbjct:  344 WIPNNVQTALCSIPPRGLKMSSTFVGNATAIQELFKRVGEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA 428          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB1_TRIVE (Tubulin beta-1 chain OS=Trichoderma virens PE=2 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 4.226e-39
Identity = 72/87 (82.76%), Postives = 83/87 (95.40%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNN+++++C IPP+GL ++STF+GNST+IQE+FRRV EQFTAMFRRKAFLHWYT EGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  344 WIPNNIQTALCSIPPKGLKISSTFVGNSTAIQEIFRRVGEQFTAMFRRKAFLHWYTSEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB1_ECHMU (Tubulin beta-1 chain OS=Echinococcus multilocularis GN=TUB-1 PE=3 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 4.226e-39
Identity = 73/85 (85.88%), Postives = 82/85 (96.47%), Query Frame = -3
Query:  440 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA 694
            WIPNNVK++VCDIPPRGL M+ TF+GN+T+IQE+F+RVSEQFT MFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ+A
Sbjct:  344 WIPNNVKTAVCDIPPRGLKMSVTFMGNTTAIQEIFKRVSEQFTVMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEA 428          
The following BLAST results are available for this feature:
BLAST of DN617298 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 258
Match NameE-valueIdentityDescription
TBB_CEPAC3.236e-3985.88Tubulin beta chain OS=Cephalosporium acremonium GN... [more]
TBB6_CHICK3.236e-3986.21Tubulin beta-6 chain OS=Gallus gallus PE=1 SV=1[more]
TBB_VENIN4.226e-3983.72Tubulin beta chain OS=Venturia inaequalis PE=3 SV=... [more]
TBB_MYCPJ4.226e-3983.72Tubulin beta chain OS=Mycosphaerella pini GN=TUB1 ... [more]
TBB_ERYGR4.226e-3983.72Tubulin beta chain OS=Erysiphe graminis subsp. hor... [more]
TBB_COCHE4.226e-3983.72Tubulin beta chain OS=Cochliobolus heterostrophus ... [more]
TBB_CERBT4.226e-3983.72Tubulin beta chain OS=Cercospora beticola GN=TUB1 ... [more]
TBB2_COLGL4.226e-3984.71Tubulin beta-2 chain OS=Colletotrichum gloeosporio... [more]
TBB1_TRIVE4.226e-3982.76Tubulin beta-1 chain OS=Trichoderma virens PE=2 SV... [more]
TBB1_ECHMU4.226e-3985.88Tubulin beta-1 chain OS=Echinococcus multiloculari... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS11_01A09_r Parent Washington Navel Orange Scale-Infested Rind cDNA Library UCRCS11 Citrus sinensis cDNA clone CS_WEd0001A09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DN617298 ID=DN617298|Name=DN617298|organism=Citrus sinensis|type=EST|length=696bp
TTTTTTTTTCCAAGGAAAAGAAATAGCATATCACATTATGGCATAATAGA
CAGTAACATAATAACATCATCGACCACAGAACATAAGAAGACAATGGCTA
AGGATAATAGAATACAAAAATAGATCAAATCCAGAATAGATAGCAAGGTA
AAGGTAGCACACACTACTACTTTCAAAACATGCATCCATCCTTTAATTTC
TCCATCCTCAATAGTCGATCCTCATCGATCCCATCATCCATCACTCACTT
TACTGCTACTTGATGTAAAAAACTCGAGAAAGAAAAACTATAACACATCA
TAGATCATTTTTTGCAATCCCAAGCAAGGTTGACAAAACCAGCTACACAG
ACAAATATGCATCATACACAACTTCTTCAAATATGATGCTCCAATTCTCC
CTCTTCCTCATCTTCATACTCGCCTTCCTCATCGGCGGTGGCATCCTGGT
ACTGCTGGTACTCAGACACGAGGTCATTCATATTGCTCTCAGCTTCAGTG
AACTCCATTTCATCCATCCCTTCACCAGTGTACCAGTGAAGGAAAGCCTT
TCTCCTAAACATAGCTGTGAATTGCTCACTCACTCTTCGGAACATTTCTT
GGATGGATGTTGAGTTCCCGATGAAGGTGGATGCCATGGAGAGACCTCTG
GGAGGAATGTCACAAACACTGGACTTCACATTGTTTGGAATCCACT
back to top