DN617298

Overview
NameDN617298
Unique NameDN617298
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length696
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9861 contig Csv1_Contig9861:1101..1793. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB1_DAUCA (Tubulin beta-1 chain (Fragment) OS=Daucus carota GN=TUBB1 PE=1 SV=2)

HSP 1 Score: 176.407 bits (446), Expect = 1.270e-43
Identity = 84/87 (96.55%), Postives = 85/87 (97.70%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVKS+VCDIPP GL MASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  212 WIPNNVKSTVCDIPPTGLKMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 298          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB1_ARATH (Tubulin beta-1 chain OS=Arabidopsis thaliana GN=TUBB1 PE=2 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 1.270e-43
Identity = 83/87 (95.40%), Postives = 85/87 (97.70%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVKSSVCDIPP G+ MASTF+GNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  345 WIPNNVKSSVCDIPPTGIKMASTFVGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 431          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB_NAEGR (Tubulin beta chain OS=Naegleria gruberi PE=2 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 1.658e-43
Identity = 82/87 (94.25%), Postives = 86/87 (98.85%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNN+KSSVCDIPPRGL MA+TFIGNST+IQEMF+RVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  344 WIPNNIKSSVCDIPPRGLKMAATFIGNSTAIQEMFKRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB5_ARATH (Tubulin beta-5 chain OS=Arabidopsis thaliana GN=TUBB5 PE=2 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 1.658e-43
Identity = 82/87 (94.25%), Postives = 86/87 (98.85%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVKSSVCDIPP+GL MA+TF+GNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLV+EYQQYQDATA
Sbjct:  345 WIPNNVKSSVCDIPPKGLKMAATFVGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVAEYQQYQDATA 431          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB5_GOSHI (Tubulin beta-5 chain OS=Gossypium hirsutum PE=2 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 2.166e-43
Identity = 83/87 (95.40%), Postives = 86/87 (98.85%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVKSSVCDIPP+GL MASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAES+MNDLV+EYQQYQDATA
Sbjct:  344 WIPNNVKSSVCDIPPKGLKMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESDMNDLVAEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB4_WHEAT (Tubulin beta-4 chain OS=Triticum aestivum GN=TUBB4 PE=2 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 2.166e-43
Identity = 82/87 (94.25%), Postives = 85/87 (97.70%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVKSSVCD+PPRGL MA TF+GNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLV+EYQQYQDATA
Sbjct:  344 WIPNNVKSSVCDMPPRGLKMAGTFVGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVAEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB3_ORYSJ (Tubulin beta-3 chain OS=Oryza sativa subsp. japonica GN=TUBB3 PE=2 SV=2)

HSP 1 Score: 175.637 bits (444), Expect = 2.166e-43
Identity = 84/87 (96.55%), Postives = 85/87 (97.70%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVKSSVCDIPP GL MASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLV+EYQQYQDATA
Sbjct:  344 WIPNNVKSSVCDIPPIGLKMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVAEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB1_PEA (Tubulin beta-1 chain OS=Pisum sativum GN=TUBB1 PE=3 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 2.828e-43
Identity = 83/87 (95.40%), Postives = 85/87 (97.70%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVKS+VCDIPP GL MASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLV+EYQQYQDATA
Sbjct:  344 WIPNNVKSTVCDIPPTGLKMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVAEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB8_ORYSJ (Tubulin beta-8 chain OS=Oryza sativa subsp. japonica GN=TUBB8 PE=2 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 4.824e-43
Identity = 83/87 (95.40%), Postives = 85/87 (97.70%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVKSSVCDIPP GLSMASTF+GNSTSIQEMFRRVSEQFTAMFRRKAFLHWYT EGMDEMEFTEAESNMNDLV+EYQQYQDATA
Sbjct:  344 WIPNNVKSSVCDIPPVGLSMASTFVGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTSEGMDEMEFTEAESNMNDLVAEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB4_ARATH (Tubulin beta-4 chain OS=Arabidopsis thaliana GN=TUBB4 PE=2 SV=2)

HSP 1 Score: 174.481 bits (441), Expect = 4.824e-43
Identity = 83/87 (95.40%), Postives = 85/87 (97.70%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVKSSVCDI P+GL MASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLV+EYQQYQDATA
Sbjct:  344 WIPNNVKSSVCDIAPKGLKMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVAEYQQYQDATA 430          
The following BLAST results are available for this feature:
BLAST of DN617298 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 258
Match NameE-valueIdentityDescription
TBB1_DAUCA1.270e-4396.55Tubulin beta-1 chain (Fragment) OS=Daucus carota G... [more]
TBB1_ARATH1.270e-4395.40Tubulin beta-1 chain OS=Arabidopsis thaliana GN=TU... [more]
TBB_NAEGR1.658e-4394.25Tubulin beta chain OS=Naegleria gruberi PE=2 SV=1[more]
TBB5_ARATH1.658e-4394.25Tubulin beta-5 chain OS=Arabidopsis thaliana GN=TU... [more]
TBB5_GOSHI2.166e-4395.40Tubulin beta-5 chain OS=Gossypium hirsutum PE=2 SV... [more]
TBB4_WHEAT2.166e-4394.25Tubulin beta-4 chain OS=Triticum aestivum GN=TUBB4... [more]
TBB3_ORYSJ2.166e-4396.55Tubulin beta-3 chain OS=Oryza sativa subsp. japoni... [more]
TBB1_PEA2.828e-4395.40Tubulin beta-1 chain OS=Pisum sativum GN=TUBB1 PE=... [more]
TBB8_ORYSJ4.824e-4395.40Tubulin beta-8 chain OS=Oryza sativa subsp. japoni... [more]
TBB4_ARATH4.824e-4395.40Tubulin beta-4 chain OS=Arabidopsis thaliana GN=TU... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS11_01A09_r Parent Washington Navel Orange Scale-Infested Rind cDNA Library UCRCS11 Citrus sinensis cDNA clone CS_WEd0001A09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DN617298 ID=DN617298|Name=DN617298|organism=Citrus sinensis|type=EST|length=696bp
TTTTTTTTTCCAAGGAAAAGAAATAGCATATCACATTATGGCATAATAGA
CAGTAACATAATAACATCATCGACCACAGAACATAAGAAGACAATGGCTA
AGGATAATAGAATACAAAAATAGATCAAATCCAGAATAGATAGCAAGGTA
AAGGTAGCACACACTACTACTTTCAAAACATGCATCCATCCTTTAATTTC
TCCATCCTCAATAGTCGATCCTCATCGATCCCATCATCCATCACTCACTT
TACTGCTACTTGATGTAAAAAACTCGAGAAAGAAAAACTATAACACATCA
TAGATCATTTTTTGCAATCCCAAGCAAGGTTGACAAAACCAGCTACACAG
ACAAATATGCATCATACACAACTTCTTCAAATATGATGCTCCAATTCTCC
CTCTTCCTCATCTTCATACTCGCCTTCCTCATCGGCGGTGGCATCCTGGT
ACTGCTGGTACTCAGACACGAGGTCATTCATATTGCTCTCAGCTTCAGTG
AACTCCATTTCATCCATCCCTTCACCAGTGTACCAGTGAAGGAAAGCCTT
TCTCCTAAACATAGCTGTGAATTGCTCACTCACTCTTCGGAACATTTCTT
GGATGGATGTTGAGTTCCCGATGAAGGTGGATGCCATGGAGAGACCTCTG
GGAGGAATGTCACAAACACTGGACTTCACATTGTTTGGAATCCACT
back to top