DN617298

Overview
NameDN617298
Unique NameDN617298
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length696
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9861 contig Csv1_Contig9861:1101..1793. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB7_MAIZE (Tubulin beta-7 chain OS=Zea mays GN=TUBB7 PE=2 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 6.301e-43
Identity = 82/87 (94.25%), Postives = 85/87 (97.70%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVKSSVCDIPP GL M+STF+GNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLV+EYQQYQDATA
Sbjct:  344 WIPNNVKSSVCDIPPIGLKMSSTFVGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVAEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB2_SOYBN (Tubulin beta-2 chain OS=Glycine max GN=TUBB2 PE=3 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 6.301e-43
Identity = 83/87 (95.40%), Postives = 85/87 (97.70%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIP+NVKS+VCDIPP GL MASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  344 WIPHNVKSTVCDIPPTGLRMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB_EUPFO (Tubulin beta chain OS=Euplotes focardii PE=3 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 8.229e-43
Identity = 80/87 (91.95%), Postives = 86/87 (98.85%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNN+KSSVCDIPP+GL M+STFIGNST+IQEMF+RV+EQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  344 WIPNNIKSSVCDIPPKGLKMSSTFIGNSTAIQEMFKRVAEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB_EUPCR (Tubulin beta chain OS=Euplotes crassus PE=3 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 8.229e-43
Identity = 80/87 (91.95%), Postives = 86/87 (98.85%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNN+KSSVCDIPP+GL +ASTFIGNST+IQEMF+RV+EQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  344 WIPNNIKSSVCDIPPKGLKLASTFIGNSTAIQEMFKRVAEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB9_GOSHI (Tubulin beta-9 chain OS=Gossypium hirsutum PE=2 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 8.229e-43
Identity = 83/87 (95.40%), Postives = 85/87 (97.70%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVKS+VCDIPP GL MASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAES+MNDLVSEYQQYQDATA
Sbjct:  344 WIPNNVKSTVCDIPPIGLKMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESDMNDLVSEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB6_GOSHI (Tubulin beta-6 chain OS=Gossypium hirsutum PE=2 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 8.229e-43
Identity = 82/86 (95.35%), Postives = 84/86 (97.67%), Query Frame = -3
Query:  437 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 694
            WIPNNVKSSVCDIPPRGL  +STFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLV+EYQQYQDAT
Sbjct:  346 WIPNNVKSSVCDIPPRGLKTSSTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVAEYQQYQDAT 431          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB_EUPOC (Tubulin beta chain OS=Euplotes octocarinatus PE=3 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 1.075e-42
Identity = 79/87 (90.80%), Postives = 86/87 (98.85%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNN+KSSVCDIPP+GL M+STF+GNST+IQEMF+RV+EQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  344 WIPNNIKSSVCDIPPKGLKMSSTFVGNSTAIQEMFKRVAEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB3_MAIZE (Tubulin beta-3 chain OS=Zea mays GN=TUBB3 PE=2 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 1.075e-42
Identity = 82/87 (94.25%), Postives = 85/87 (97.70%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVKSSVCDIPP GLSM+STF+GNSTSIQEMFRRVSEQFTAMFRRKAFLHWYT EGMDEMEFTEAESNMNDLV+EYQQYQDATA
Sbjct:  344 WIPNNVKSSVCDIPPVGLSMSSTFVGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTSEGMDEMEFTEAESNMNDLVAEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB2_SOLTU (Tubulin beta-2 chain OS=Solanum tuberosum GN=TUBB2 PE=2 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 1.075e-42
Identity = 82/87 (94.25%), Postives = 84/87 (96.55%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVKSSVCDIPP GL MASTF+GNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMND V+EYQQYQDATA
Sbjct:  347 WIPNNVKSSVCDIPPTGLKMASTFVGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDPVAEYQQYQDATA 433          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB1_SOLTU (Tubulin beta-1 chain OS=Solanum tuberosum GN=TUBB1 PE=2 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 1.075e-42
Identity = 82/87 (94.25%), Postives = 84/87 (96.55%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVKSSVCDIPP GL MASTF+GNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMND V+EYQQYQDATA
Sbjct:  347 WIPNNVKSSVCDIPPTGLKMASTFVGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDPVAEYQQYQDATA 433          
The following BLAST results are available for this feature:
BLAST of DN617298 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 258
Match NameE-valueIdentityDescription
TBB7_MAIZE6.301e-4394.25Tubulin beta-7 chain OS=Zea mays GN=TUBB7 PE=2 SV=... [more]
TBB2_SOYBN6.301e-4395.40Tubulin beta-2 chain OS=Glycine max GN=TUBB2 PE=3 ... [more]
TBB_EUPFO8.229e-4391.95Tubulin beta chain OS=Euplotes focardii PE=3 SV=1[more]
TBB_EUPCR8.229e-4391.95Tubulin beta chain OS=Euplotes crassus PE=3 SV=1[more]
TBB9_GOSHI8.229e-4395.40Tubulin beta-9 chain OS=Gossypium hirsutum PE=2 SV... [more]
TBB6_GOSHI8.229e-4395.35Tubulin beta-6 chain OS=Gossypium hirsutum PE=2 SV... [more]
TBB_EUPOC1.075e-4290.80Tubulin beta chain OS=Euplotes octocarinatus PE=3 ... [more]
TBB3_MAIZE1.075e-4294.25Tubulin beta-3 chain OS=Zea mays GN=TUBB3 PE=2 SV=... [more]
TBB2_SOLTU1.075e-4294.25Tubulin beta-2 chain OS=Solanum tuberosum GN=TUBB2... [more]
TBB1_SOLTU1.075e-4294.25Tubulin beta-1 chain OS=Solanum tuberosum GN=TUBB1... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS11_01A09_r Parent Washington Navel Orange Scale-Infested Rind cDNA Library UCRCS11 Citrus sinensis cDNA clone CS_WEd0001A09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DN617298 ID=DN617298|Name=DN617298|organism=Citrus sinensis|type=EST|length=696bp
TTTTTTTTTCCAAGGAAAAGAAATAGCATATCACATTATGGCATAATAGA
CAGTAACATAATAACATCATCGACCACAGAACATAAGAAGACAATGGCTA
AGGATAATAGAATACAAAAATAGATCAAATCCAGAATAGATAGCAAGGTA
AAGGTAGCACACACTACTACTTTCAAAACATGCATCCATCCTTTAATTTC
TCCATCCTCAATAGTCGATCCTCATCGATCCCATCATCCATCACTCACTT
TACTGCTACTTGATGTAAAAAACTCGAGAAAGAAAAACTATAACACATCA
TAGATCATTTTTTGCAATCCCAAGCAAGGTTGACAAAACCAGCTACACAG
ACAAATATGCATCATACACAACTTCTTCAAATATGATGCTCCAATTCTCC
CTCTTCCTCATCTTCATACTCGCCTTCCTCATCGGCGGTGGCATCCTGGT
ACTGCTGGTACTCAGACACGAGGTCATTCATATTGCTCTCAGCTTCAGTG
AACTCCATTTCATCCATCCCTTCACCAGTGTACCAGTGAAGGAAAGCCTT
TCTCCTAAACATAGCTGTGAATTGCTCACTCACTCTTCGGAACATTTCTT
GGATGGATGTTGAGTTCCCGATGAAGGTGGATGCCATGGAGAGACCTCTG
GGAGGAATGTCACAAACACTGGACTTCACATTGTTTGGAATCCACT
back to top