DN617298

Overview
NameDN617298
Unique NameDN617298
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length696
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9861 contig Csv1_Contig9861:1101..1793. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB1_ANEPH (Tubulin beta-1 chain OS=Anemia phyllitidis GN=TUBB1 PE=2 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 1.075e-42
Identity = 83/87 (95.40%), Postives = 84/87 (96.55%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVKSSVCDIPP GL MA TFIGNSTSIQEMFRRVS+QFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  344 WIPNNVKSSVCDIPPVGLKMAVTFIGNSTSIQEMFRRVSDQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB_POLAG (Tubulin beta chain OS=Polytomella agilis GN=TUBB1 PE=3 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 1.833e-42
Identity = 80/87 (91.95%), Postives = 86/87 (98.85%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVKSSVCDIPP+GL M++TFIGNST+IQEMF+RVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA+A
Sbjct:  344 WIPNNVKSSVCDIPPKGLKMSATFIGNSTAIQEMFKRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDASA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB_CHLRE (Tubulin beta-1/beta-2 chain OS=Chlamydomonas reinhardtii GN=TUBB1 PE=3 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 1.833e-42
Identity = 80/87 (91.95%), Postives = 86/87 (98.85%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVKSSVCDIPP+GL M++TFIGNST+IQEMF+RVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA+A
Sbjct:  344 WIPNNVKSSVCDIPPKGLKMSATFIGNSTAIQEMFKRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDASA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB_CHLIN (Tubulin beta chain OS=Chlamydomonas incerta GN=TUBB PE=3 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 1.833e-42
Identity = 80/87 (91.95%), Postives = 86/87 (98.85%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVKSSVCDIPP+GL M++TFIGNST+IQEMF+RVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA+A
Sbjct:  344 WIPNNVKSSVCDIPPKGLKMSATFIGNSTAIQEMFKRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDASA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB_ACHKL (Tubulin beta chain OS=Achlya klebsiana PE=2 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 1.833e-42
Identity = 79/87 (90.80%), Postives = 86/87 (98.85%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNN+K+SVCDIPP+GL M++TFIGNST+IQEMF+RVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  342 WIPNNIKASVCDIPPKGLKMSTTFIGNSTAIQEMFKRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 428          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB4_MOUSE (Tubulin beta-4 chain OS=Mus musculus GN=Tubb4 PE=1 SV=3)

HSP 1 Score: 172.555 bits (436), Expect = 1.833e-42
Identity = 79/87 (90.80%), Postives = 86/87 (98.85%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVK++VCDIPPRGL MA+TFIGNST+IQE+F+R+SEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  344 WIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB4_MAIZE (Tubulin beta-4 chain OS=Zea mays GN=TUBB4 PE=2 SV=2)

HSP 1 Score: 172.555 bits (436), Expect = 1.833e-42
Identity = 82/87 (94.25%), Postives = 84/87 (96.55%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVKSSVCDIPP GL MASTF+GNSTSIQEMFRRVSEQFTAMFRRKAFLHWYT EGMDEMEFTEAESNMNDLV+EYQQYQDATA
Sbjct:  346 WIPNNVKSSVCDIPPVGLPMASTFVGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTSEGMDEMEFTEAESNMNDLVAEYQQYQDATA 432          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB4_MACFA (Tubulin beta-4 chain OS=Macaca fascicularis GN=TUBB4 PE=2 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 1.833e-42
Identity = 79/87 (90.80%), Postives = 86/87 (98.85%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVK++VCDIPPRGL MA+TFIGNST+IQE+F+R+SEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  344 WIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB4_HUMAN (Tubulin beta-4 chain OS=Homo sapiens GN=TUBB4 PE=1 SV=2)

HSP 1 Score: 172.555 bits (436), Expect = 1.833e-42
Identity = 79/87 (90.80%), Postives = 86/87 (98.85%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVK++VCDIPPRGL MA+TFIGNST+IQE+F+R+SEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  344 WIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB4_BOVIN (Tubulin beta-4 chain OS=Bos taurus GN=TUBB4 PE=2 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 1.833e-42
Identity = 79/87 (90.80%), Postives = 86/87 (98.85%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVK++VCDIPPRGL MA+TFIGNST+IQE+F+R+SEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  344 WIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
The following BLAST results are available for this feature:
BLAST of DN617298 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 258
Match NameE-valueIdentityDescription
TBB1_ANEPH1.075e-4295.40Tubulin beta-1 chain OS=Anemia phyllitidis GN=TUBB... [more]
TBB_POLAG1.833e-4291.95Tubulin beta chain OS=Polytomella agilis GN=TUBB1 ... [more]
TBB_CHLRE1.833e-4291.95Tubulin beta-1/beta-2 chain OS=Chlamydomonas reinh... [more]
TBB_CHLIN1.833e-4291.95Tubulin beta chain OS=Chlamydomonas incerta GN=TUB... [more]
TBB_ACHKL1.833e-4290.80Tubulin beta chain OS=Achlya klebsiana PE=2 SV=1[more]
TBB4_MOUSE1.833e-4290.80Tubulin beta-4 chain OS=Mus musculus GN=Tubb4 PE=1... [more]
TBB4_MAIZE1.833e-4294.25Tubulin beta-4 chain OS=Zea mays GN=TUBB4 PE=2 SV=... [more]
TBB4_MACFA1.833e-4290.80Tubulin beta-4 chain OS=Macaca fascicularis GN=TUB... [more]
TBB4_HUMAN1.833e-4290.80Tubulin beta-4 chain OS=Homo sapiens GN=TUBB4 PE=1... [more]
TBB4_BOVIN1.833e-4290.80Tubulin beta-4 chain OS=Bos taurus GN=TUBB4 PE=2 S... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS11_01A09_r Parent Washington Navel Orange Scale-Infested Rind cDNA Library UCRCS11 Citrus sinensis cDNA clone CS_WEd0001A09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DN617298 ID=DN617298|Name=DN617298|organism=Citrus sinensis|type=EST|length=696bp
TTTTTTTTTCCAAGGAAAAGAAATAGCATATCACATTATGGCATAATAGA
CAGTAACATAATAACATCATCGACCACAGAACATAAGAAGACAATGGCTA
AGGATAATAGAATACAAAAATAGATCAAATCCAGAATAGATAGCAAGGTA
AAGGTAGCACACACTACTACTTTCAAAACATGCATCCATCCTTTAATTTC
TCCATCCTCAATAGTCGATCCTCATCGATCCCATCATCCATCACTCACTT
TACTGCTACTTGATGTAAAAAACTCGAGAAAGAAAAACTATAACACATCA
TAGATCATTTTTTGCAATCCCAAGCAAGGTTGACAAAACCAGCTACACAG
ACAAATATGCATCATACACAACTTCTTCAAATATGATGCTCCAATTCTCC
CTCTTCCTCATCTTCATACTCGCCTTCCTCATCGGCGGTGGCATCCTGGT
ACTGCTGGTACTCAGACACGAGGTCATTCATATTGCTCTCAGCTTCAGTG
AACTCCATTTCATCCATCCCTTCACCAGTGTACCAGTGAAGGAAAGCCTT
TCTCCTAAACATAGCTGTGAATTGCTCACTCACTCTTCGGAACATTTCTT
GGATGGATGTTGAGTTCCCGATGAAGGTGGATGCCATGGAGAGACCTCTG
GGAGGAATGTCACAAACACTGGACTTCACATTGTTTGGAATCCACT
back to top