DN617298

Overview
NameDN617298
Unique NameDN617298
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length696
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9861 contig Csv1_Contig9861:1101..1793. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB2_ECHMU (Tubulin beta-2 chain OS=Echinococcus multilocularis GN=TUB-2 PE=3 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 1.833e-42
Identity = 79/87 (90.80%), Postives = 86/87 (98.85%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVK++VCDIPPRGL M++TF+GNST+IQE+FRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  344 WIPNNVKTAVCDIPPRGLKMSATFVGNSTAIQELFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB1_VOLCA (Tubulin beta chain OS=Volvox carteri GN=TUBB1 PE=3 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 1.833e-42
Identity = 80/87 (91.95%), Postives = 86/87 (98.85%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVKSSVCDIPP+GL M++TFIGNST+IQEMF+RVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA+A
Sbjct:  344 WIPNNVKSSVCDIPPKGLKMSATFIGNSTAIQEMFKRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDASA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB1_NOTCO (Tubulin beta-1 chain OS=Notothenia coriiceps neglecta GN=tubb1 PE=1 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 1.833e-42
Identity = 79/87 (90.80%), Postives = 86/87 (98.85%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVK++VCDIPPRGL MA+TFIGNST+IQE+F+R+SEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  344 WIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB1_GADMO (Tubulin beta-1 chain OS=Gadus morhua PE=2 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 1.833e-42
Identity = 79/87 (90.80%), Postives = 86/87 (98.85%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVK++VCDIPPRGL MA+TFIGNST+IQE+F+R+SEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  344 WIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB1_CYAPA (Tubulin beta-1 chain OS=Cyanophora paradoxa GN=TUBB1 PE=2 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 1.833e-42
Identity = 79/87 (90.80%), Postives = 86/87 (98.85%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNN+K+SVCDIPP+GL M++TFIGNST+IQEMF+RVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  344 WIPNNIKASVCDIPPKGLKMSATFIGNSTAIQEMFKRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB7_GOSHI (Tubulin beta-7 chain OS=Gossypium hirsutum PE=2 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 2.394e-42
Identity = 81/87 (93.10%), Postives = 84/87 (96.55%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVKSSVCDIPP GL+M+STF+GNSTSIQEMFRRVSEQFT MFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA A
Sbjct:  344 WIPNNVKSSVCDIPPTGLTMSSTFMGNSTSIQEMFRRVSEQFTVMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAVA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB_TETTH (Tubulin beta chain OS=Tetrahymena thermophila GN=BTU1 PE=1 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 3.127e-42
Identity = 78/87 (89.66%), Postives = 85/87 (97.70%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNN+KSS+CDIPP+GL MA TF+GNST+IQEMF+RV+EQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  344 WIPNNIKSSICDIPPKGLKMAVTFVGNSTAIQEMFKRVAEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB_TETPY (Tubulin beta chain OS=Tetrahymena pyriformis GN=BETA-TT1 PE=3 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 3.127e-42
Identity = 78/87 (89.66%), Postives = 85/87 (97.70%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNN+KSS+CDIPP+GL MA TF+GNST+IQEMF+RV+EQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  344 WIPNNIKSSICDIPPKGLKMAVTFVGNSTAIQEMFKRVAEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB_PSEAM (Tubulin beta chain OS=Pseudopleuronectes americanus PE=2 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 3.127e-42
Identity = 79/87 (90.80%), Postives = 86/87 (98.85%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVK++VCDIPPRGL M+STFIGNST+IQE+F+R+SEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  344 WIPNNVKTAVCDIPPRGLKMSSTFIGNSTAIQELFKRMSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB_CICAR (Tubulin beta chain OS=Cicer arietinum GN=TUBB PE=2 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 3.127e-42
Identity = 81/87 (93.10%), Postives = 84/87 (96.55%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVKSSVCDIPP+ L M+STFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLV+EYQQYQDA A
Sbjct:  346 WIPNNVKSSVCDIPPKNLKMSSTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVAEYQQYQDAIA 432          
The following BLAST results are available for this feature:
BLAST of DN617298 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 258
Match NameE-valueIdentityDescription
TBB2_ECHMU1.833e-4290.80Tubulin beta-2 chain OS=Echinococcus multiloculari... [more]
TBB1_VOLCA1.833e-4291.95Tubulin beta chain OS=Volvox carteri GN=TUBB1 PE=3... [more]
TBB1_NOTCO1.833e-4290.80Tubulin beta-1 chain OS=Notothenia coriiceps negle... [more]
TBB1_GADMO1.833e-4290.80Tubulin beta-1 chain OS=Gadus morhua PE=2 SV=1[more]
TBB1_CYAPA1.833e-4290.80Tubulin beta-1 chain OS=Cyanophora paradoxa GN=TUB... [more]
TBB7_GOSHI2.394e-4293.10Tubulin beta-7 chain OS=Gossypium hirsutum PE=2 SV... [more]
TBB_TETTH3.127e-4289.66Tubulin beta chain OS=Tetrahymena thermophila GN=B... [more]
TBB_TETPY3.127e-4289.66Tubulin beta chain OS=Tetrahymena pyriformis GN=BE... [more]
TBB_PSEAM3.127e-4290.80Tubulin beta chain OS=Pseudopleuronectes americanu... [more]
TBB_CICAR3.127e-4293.10Tubulin beta chain OS=Cicer arietinum GN=TUBB PE=2... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS11_01A09_r Parent Washington Navel Orange Scale-Infested Rind cDNA Library UCRCS11 Citrus sinensis cDNA clone CS_WEd0001A09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DN617298 ID=DN617298|Name=DN617298|organism=Citrus sinensis|type=EST|length=696bp
TTTTTTTTTCCAAGGAAAAGAAATAGCATATCACATTATGGCATAATAGA
CAGTAACATAATAACATCATCGACCACAGAACATAAGAAGACAATGGCTA
AGGATAATAGAATACAAAAATAGATCAAATCCAGAATAGATAGCAAGGTA
AAGGTAGCACACACTACTACTTTCAAAACATGCATCCATCCTTTAATTTC
TCCATCCTCAATAGTCGATCCTCATCGATCCCATCATCCATCACTCACTT
TACTGCTACTTGATGTAAAAAACTCGAGAAAGAAAAACTATAACACATCA
TAGATCATTTTTTGCAATCCCAAGCAAGGTTGACAAAACCAGCTACACAG
ACAAATATGCATCATACACAACTTCTTCAAATATGATGCTCCAATTCTCC
CTCTTCCTCATCTTCATACTCGCCTTCCTCATCGGCGGTGGCATCCTGGT
ACTGCTGGTACTCAGACACGAGGTCATTCATATTGCTCTCAGCTTCAGTG
AACTCCATTTCATCCATCCCTTCACCAGTGTACCAGTGAAGGAAAGCCTT
TCTCCTAAACATAGCTGTGAATTGCTCACTCACTCTTCGGAACATTTCTT
GGATGGATGTTGAGTTCCCGATGAAGGTGGATGCCATGGAGAGACCTCTG
GGAGGAATGTCACAAACACTGGACTTCACATTGTTTGGAATCCACT
back to top