DN135279
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of DN135279 vs. ExPASy Swiss-Prot
Match: COX2_ASCSU (Cytochrome c oxidase subunit 2 OS=Ascaris suum GN=COII PE=3 SV=2) HSP 1 Score: 79.337 bits (194), Expect = 1.897e-14 Identity = 39/83 (46.99%), Postives = 55/83 (66.27%), Query Frame = 3 Query: 411 EILWTIFPSIILMFIAIPSFALLYSMDEVVVDPAITIKAIGHQWYWTYEYSDYNSSDEQSLIFDSYMIPEDDLELGQLRLLXV 659 E+L ++FP++IL+ +PS +LLY + +D ++T+K GHQWYW+YE+SD L FDSYM D LELG+ RLL V Sbjct: 64 ELLCSVFPTLILVMQMVPSLSLLYYYGLMNLDSSLTVKVTGHQWYWSYEFSDI-----PGLEFDSYMKSLDQLELGEPRLLEV 141
BLAST of DN135279 vs. ExPASy Swiss-Prot
Match: COX2_APIFL (Cytochrome c oxidase subunit 2 OS=Apis florea GN=COII PE=3 SV=1) HSP 1 Score: 79.337 bits (194), Expect = 1.897e-14 Identity = 40/82 (48.78%), Postives = 55/82 (67.07%), Query Frame = 3 Query: 408 IEILWTIFPSIILMFIAIPSFALLYSMDEVVVDPAITIKAIGHQWYWTYEYSDYNSSDEQSLIFDSYMIPEDDLELGQLRLL 653 IEI+W I P +IL+ I PS +LY +DE+V +P +IK+IGHQWYW+YEY ++N+ + F SYM+ D L Q RLL Sbjct: 61 IEIIWMIVPIVILLIICFPSLKILYLIDEIV-NPFFSIKSIGHQWYWSYEYPEFNNIE-----FYSYMLNYSD--LNQFRLL 134 The following BLAST results are available for this feature:
BLAST of DN135279 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 302
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >DN135279 ID=DN135279; Name=DN135279; organism=Citrus sinensis; type=EST; length=660bpback to top |