DT214565

Overview
NameDT214565
Unique NameDT214565
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length713
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DT214565_ssr591 microsatellite DT214565_ssr591:591..614. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig7552 contig Csv1_Contig7552:60..774. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS_PYRPY (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Pyrus pyrifolia GN=RBCS PE=2 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 5.743e-31
Identity = 58/77 (75.32%), Postives = 68/77 (88.31%), Query Frame = -3
Query:  130 LQKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 360
            L+ G+VYRE+H SPGYYDGRYWTMWKLPM+GCTD++QVLKE+ E +K YP SF+RIIGFDN RQVQCISF+A KP G
Sbjct:  106 LETGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPQSFIRIIGFDNVRQVQCISFIAYKPAG 182          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS_MALSP (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Malus sp. GN=RBCS PE=2 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 5.743e-31
Identity = 58/77 (75.32%), Postives = 68/77 (88.31%), Query Frame = -3
Query:  130 LQKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 360
            L+ G+VYRE+H SPGYYDGRYWTMWKLPM+GCTD++QVLKE+ E +K YP SF+RIIGFDN RQVQCISF+A KP G
Sbjct:  106 LEHGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPQSFIRIIGFDNVRQVQCISFIAYKPAG 182          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS_RAPSA (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Raphanus sativus GN=RBCS PE=2 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 7.500e-31
Identity = 57/76 (75.00%), Postives = 68/76 (89.47%), Query Frame = -3
Query:  133 LQKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPP 360
            L+ G+VYREH S+PGYYDGRYWTMWKLP++GCTD+ QVLKEV E +KEYP++ +RIIGFDN RQVQCISF+A KPP
Sbjct:  101 LEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKKEYPNALIRIIGFDNNRQVQCISFIAYKPP 176          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS_BETVE (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Betula verrucosa GN=RBCS1 PE=2 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 7.500e-31
Identity = 58/78 (74.36%), Postives = 69/78 (88.46%), Query Frame = -3
Query:  127 LQKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPGV 360
            L+ G+VYREH+ SPGYYDGRYWTMWKLPM+GC D++QVLKE+ E +K YP +F+RIIGFDNKRQVQ ISF+A KPPGV
Sbjct:  105 LEHGFVYREHNRSPGYYDGRYWTMWKLPMFGCNDSSQVLKELEECKKAYPSAFIRIIGFDNKRQVQIISFIAYKPPGV 182          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS2_BRANA (Ribulose bisphosphate carboxylase small chain F1, chloroplastic OS=Brassica napus GN=RBCS F1 PE=3 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 7.500e-31
Identity = 57/76 (75.00%), Postives = 68/76 (89.47%), Query Frame = -3
Query:  133 LQKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPP 360
            L+ G+VYREH S+PGYYDGRYWTMWKLP++GCTD+ QVLKEV E + EYP++F+RIIGFDN RQVQCISF+A KPP
Sbjct:  101 LEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKTEYPNAFIRIIGFDNNRQVQCISFIAYKPP 176          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS1_BRANA (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Brassica napus GN=RBCS PE=2 SV=2)

HSP 1 Score: 134.035 bits (336), Expect = 7.500e-31
Identity = 57/76 (75.00%), Postives = 68/76 (89.47%), Query Frame = -3
Query:  133 LQKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPP 360
            L+ G+VYREH S+PGYYDGRYWTMWKLP++GCTD+ QVLKEV E + EYP++F+RIIGFDN RQVQCISF+A KPP
Sbjct:  101 LEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVQECKTEYPNAFIRIIGFDNNRQVQCISFIAYKPP 176          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS3B_ARATH (Ribulose bisphosphate carboxylase small chain 3B, chloroplastic OS=Arabidopsis thaliana GN=RBCS-3B PE=1 SV=2)

HSP 1 Score: 133.65 bits (335), Expect = 9.796e-31
Identity = 57/76 (75.00%), Postives = 68/76 (89.47%), Query Frame = -3
Query:  133 LQKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPP 360
            L+ G+VYREH ++PGYYDGRYWTMWKLP++GCTD+ QVLKEV E +KEYP +F+RIIGFDN RQVQCISF+A KPP
Sbjct:  101 LEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPGAFIRIIGFDNTRQVQCISFIAYKPP 176          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS2B_ARATH (Ribulose bisphosphate carboxylase small chain 2B, chloroplastic OS=Arabidopsis thaliana GN=RBCS-2B PE=2 SV=2)

HSP 1 Score: 133.65 bits (335), Expect = 9.796e-31
Identity = 57/76 (75.00%), Postives = 68/76 (89.47%), Query Frame = -3
Query:  133 LQKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPP 360
            L+ G+VYREH ++PGYYDGRYWTMWKLP++GCTD+ QVLKEV E +KEYP +F+RIIGFDN RQVQCISF+A KPP
Sbjct:  101 LEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPGAFIRIIGFDNTRQVQCISFIAYKPP 176          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS1B_ARATH (Ribulose bisphosphate carboxylase small chain 1B, chloroplastic OS=Arabidopsis thaliana GN=RBCS-1B PE=1 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 9.796e-31
Identity = 57/76 (75.00%), Postives = 68/76 (89.47%), Query Frame = -3
Query:  133 LQKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPP 360
            L+ G+VYREH ++PGYYDGRYWTMWKLP++GCTD+ QVLKEV E +KEYP +F+RIIGFDN RQVQCISF+A KPP
Sbjct:  101 LEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPGAFIRIIGFDNTRQVQCISFIAYKPP 176          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS2_ORYSJ (Ribulose bisphosphate carboxylase small chain A, chloroplastic OS=Oryza sativa subsp. japonica GN=RBCS-A PE=2 SV=2)

HSP 1 Score: 133.265 bits (334), Expect = 1.279e-30
Identity = 59/74 (79.73%), Postives = 66/74 (89.19%), Query Frame = -3
Query:  130 GWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 351
            G+VYRE+H SPGYYDGRYWTMWKLPM+GCTDATQVLKE+ E +K YP +FVRIIGFDN RQVQ ISF+A KPPG
Sbjct:   95 GFVYRENHRSPGYYDGRYWTMWKLPMFGCTDATQVLKELEEAKKAYPDAFVRIIGFDNVRQVQLISFIAYKPPG 168          
The following BLAST results are available for this feature:
BLAST of DT214565 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 111
Match NameE-valueIdentityDescription
RBS_PYRPY5.743e-3175.32Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS_MALSP5.743e-3175.32Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS_RAPSA7.500e-3175.00Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS_BETVE7.500e-3174.36Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS2_BRANA7.500e-3175.00Ribulose bisphosphate carboxylase small chain F1, ... [more]
RBS1_BRANA7.500e-3175.00Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS3B_ARATH9.796e-3175.00Ribulose bisphosphate carboxylase small chain 3B, ... [more]
RBS2B_ARATH9.796e-3175.00Ribulose bisphosphate carboxylase small chain 2B, ... [more]
RBS1B_ARATH9.796e-3175.00Ribulose bisphosphate carboxylase small chain 1B, ... [more]
RBS2_ORYSJ1.279e-3079.73Ribulose bisphosphate carboxylase small chain A, c... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS10_22B11_b2 Madame Vinous Sweet Orange Multiple Pathogen-Infected cDNA Library UCRCS10-2 Citrus sinensis cDNA clone UCRCS10-22B11-C22-5.d-polyt, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DT214565 ID=DT214565|Name=DT214565|organism=Citrus sinensis|type=EST|length=713bp
ACAGCAGCCTAAGTAAAATTAAACGCAAACCGAACCCCCATTGATCGAAT
GATCATTATGGGGGTTACACATAATAATAATCAACAATATTGCATGGGTG
GTTACACAAATTTAATTGGGAACCTAGACGCCTGGTGGCTTGGCAGCAAG
GAAACTGATGCACTGCACTTGACGCTTGTTGTCAAATCCGATAATTCGGA
CGAATGAATGTGGGTATTCCTTCTGGACCTCCCCAACCTCCTTCAAAACC
TGGGTTGCATCTGTGCACCCATACATGGGCAGCTTCCACATTGTCCAGTA
GCGTCCATCGTAGTATCCTGGTGAGCTGTGGTGCTCACGGTACACCCATC
CTTTCTGCAGTCACGCCACCCAAAAGAAAAAACAAAAAAAAAAAAAAATC
AAATATCACCACCCATTTGCCTGATAAAATCCGCTTAACCCAAAAGCTTA
AATTTTAAGTAAGCAATTGTTAATGCAGGTTTTGATATTGAATGGATATC
TCTGACCAATAAATTCATGACATGTGTAATTTTTCTCCTAAAGCACATAA
ATAAGGTTCCGTCAAAATAATAGTATATATTAAGAGAGACAGAGAGAGAG
AGAGAGAGAGAGAGAAATGACCTCCAACTCAAATTCCAAGCAGGAAATCC
AGCCGGAGCGGAGAAGGTAACTGATTTCCTTGAGCAAAGCTTCATCGGAC
AGTGGCGGGAGGT
back to top