DT214565

Overview
NameDT214565
Unique NameDT214565
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length713
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DT214565_ssr591 microsatellite DT214565_ssr591:591..614. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig7552 contig Csv1_Contig7552:60..774. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS3A_SOLLC (Ribulose bisphosphate carboxylase small chain 3A/3C, chloroplastic OS=Solanum lycopersicum GN=RBCS-3A/3C PE=3 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 2.850e-30
Identity = 58/76 (76.32%), Postives = 66/76 (86.84%), Query Frame = -3
Query:  130 QKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 357
            + G+VYRE+H SPGYYDGRYWTMWKLPM+GCTDATQVL EV E +K YP ++VRIIGFDN RQVQCISF+A KP G
Sbjct:  104 EHGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAWVRIIGFDNVRQVQCISFIAYKPEG 179          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS2_LEMGI (Ribulose bisphosphate carboxylase small chain SSU26, chloroplastic OS=Lemna gibba GN=SSU26 PE=3 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 2.850e-30
Identity = 57/74 (77.03%), Postives = 67/74 (90.54%), Query Frame = -3
Query:  136 QKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKP 357
            ++G+VYRE+H+SPGYYDGRYWTMWKLPM+GCTDA+QV+ EV E +K YP  FVRIIGFDNKRQVQCISF+A KP
Sbjct:  103 KEGFVYRENHASPGYYDGRYWTMWKLPMFGCTDASQVIAEVEEAKKAYPEYFVRIIGFDNKRQVQCISFIAYKP 176          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS1_SOLLC (Ribulose bisphosphate carboxylase small chain 1, chloroplastic OS=Solanum lycopersicum GN=RBCS-1 PE=2 SV=2)

HSP 1 Score: 132.109 bits (331), Expect = 2.850e-30
Identity = 58/76 (76.32%), Postives = 68/76 (89.47%), Query Frame = -3
Query:  130 QKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 357
            ++G+VYRE++SSPGYYDGRYWTMWKLPM+GCTDATQVL EV E +K YP ++VRIIGFDN RQVQCISF+A KP G
Sbjct:  105 ERGFVYRENNSSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAWVRIIGFDNVRQVQCISFIAYKPEG 180          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS3_SOLTU (Ribulose bisphosphate carboxylase small chain 3, chloroplastic OS=Solanum tuberosum GN=RBCS-3 PE=3 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 3.722e-30
Identity = 57/76 (75.00%), Postives = 66/76 (86.84%), Query Frame = -3
Query:  130 QKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 357
            + G+VYRE+H SPGYYDGRYWTMWKLPM+GCTDATQVL EV E +K YP +++RIIGFDN RQVQCISF+A KP G
Sbjct:  105 EHGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 180          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS3_AMAHP (Ribulose bisphosphate carboxylase small chain 3, chloroplastic OS=Amaranthus hypochondriacus GN=RBCS3 PE=2 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 3.722e-30
Identity = 57/77 (74.03%), Postives = 65/77 (84.42%), Query Frame = -3
Query:  130 LQKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 360
            L+  +VYRE+H SPGY DGRYWTMWKLPMYGCTD  QVL EV E +K YP +F+RIIGFDNKRQVQC+SF+A KPPG
Sbjct:  103 LEHPFVYRENHRSPGYQDGRYWTMWKLPMYGCTDPAQVLNEVEEAKKAYPSAFIRIIGFDNKRQVQCVSFIAFKPPG 179          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS1_SOLTU (Ribulose bisphosphate carboxylase small chain 1, chloroplastic OS=Solanum tuberosum GN=RBCS-1 PE=3 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 3.722e-30
Identity = 57/76 (75.00%), Postives = 66/76 (86.84%), Query Frame = -3
Query:  130 QKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 357
            + G+VYRE+H SPGYYDGRYWTMWKLPM+GCTDATQVL EV E +K YP +++RIIGFDN RQVQCISF+A KP G
Sbjct:  105 EHGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQECKKSYPQAWIRIIGFDNVRQVQCISFIAYKPEG 180          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS_GLYTO (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Glycine tomentella GN=RBCS PE=3 SV=1)

HSP 1 Score: 131.339 bits (329), Expect = 4.862e-30
Identity = 56/76 (73.68%), Postives = 67/76 (88.16%), Query Frame = -3
Query:  133 LQKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPP 360
            L+ G+VYRE+H SPGYYDGRYWTMWKLP++GCTDA+QVLKE+ E +  YP+ F+RIIGFDN RQVQCISF+A KPP
Sbjct:  101 LEHGFVYRENHRSPGYYDGRYWTMWKLPVFGCTDASQVLKELQEAKTAYPNGFIRIIGFDNVRQVQCISFIAYKPP 176          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS2_PETHY (Ribulose bisphosphate carboxylase small chain SSU11A, chloroplastic OS=Petunia hybrida GN=RBCS PE=3 SV=1)

HSP 1 Score: 131.339 bits (329), Expect = 4.862e-30
Identity = 56/76 (73.68%), Postives = 68/76 (89.47%), Query Frame = -3
Query:  130 QKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 357
            + G+VYRE+H+SP YYDGRYWTMWKLPM+GCTDATQVL E+ E +K YP++++RIIGFDN RQVQCISF+A KPPG
Sbjct:  104 EHGFVYREYHASPRYYDGRYWTMWKLPMFGCTDATQVLGELQEAKKAYPNAWIRIIGFDNVRQVQCISFIAYKPPG 179          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS1_PETHY (Ribulose bisphosphate carboxylase small chain SSU8, chloroplastic OS=Petunia hybrida GN=RBCS PE=3 SV=1)

HSP 1 Score: 131.339 bits (329), Expect = 4.862e-30
Identity = 56/76 (73.68%), Postives = 68/76 (89.47%), Query Frame = -3
Query:  130 QKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 357
            + G+VYRE+H+SP YYDGRYWTMWKLPM+GCTDATQVL E+ E +K YP++++RIIGFDN RQVQCISF+A KPPG
Sbjct:  104 EHGFVYREYHASPRYYDGRYWTMWKLPMFGCTDATQVLGELQEAKKAYPNAWIRIIGFDNVRQVQCISFIAYKPPG 179          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS_FLATR (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Flaveria trinervia GN=RBCS PE=2 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 6.349e-30
Identity = 55/77 (71.43%), Postives = 69/77 (89.61%), Query Frame = -3
Query:  130 LQKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 360
            L+ G+VYRE+ SSPGYYDGRYWTMWKLPM+GCTD+ QV+KE+ E +KEYP +++RIIGFDN RQVQC+SF+A+KP G
Sbjct:   96 LEHGFVYRENASSPGYYDGRYWTMWKLPMFGCTDSAQVMKELQECKKEYPQAWIRIIGFDNVRQVQCVSFIASKPTG 172          
The following BLAST results are available for this feature:
BLAST of DT214565 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 111
Match NameE-valueIdentityDescription
RBS3A_SOLLC2.850e-3076.32Ribulose bisphosphate carboxylase small chain 3A/3... [more]
RBS2_LEMGI2.850e-3077.03Ribulose bisphosphate carboxylase small chain SSU2... [more]
RBS1_SOLLC2.850e-3076.32Ribulose bisphosphate carboxylase small chain 1, c... [more]
RBS3_SOLTU3.722e-3075.00Ribulose bisphosphate carboxylase small chain 3, c... [more]
RBS3_AMAHP3.722e-3074.03Ribulose bisphosphate carboxylase small chain 3, c... [more]
RBS1_SOLTU3.722e-3075.00Ribulose bisphosphate carboxylase small chain 1, c... [more]
RBS_GLYTO4.862e-3073.68Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS2_PETHY4.862e-3073.68Ribulose bisphosphate carboxylase small chain SSU1... [more]
RBS1_PETHY4.862e-3073.68Ribulose bisphosphate carboxylase small chain SSU8... [more]
RBS_FLATR6.349e-3071.43Ribulose bisphosphate carboxylase small chain, chl... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS10_22B11_b2 Madame Vinous Sweet Orange Multiple Pathogen-Infected cDNA Library UCRCS10-2 Citrus sinensis cDNA clone UCRCS10-22B11-C22-5.d-polyt, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DT214565 ID=DT214565|Name=DT214565|organism=Citrus sinensis|type=EST|length=713bp
ACAGCAGCCTAAGTAAAATTAAACGCAAACCGAACCCCCATTGATCGAAT
GATCATTATGGGGGTTACACATAATAATAATCAACAATATTGCATGGGTG
GTTACACAAATTTAATTGGGAACCTAGACGCCTGGTGGCTTGGCAGCAAG
GAAACTGATGCACTGCACTTGACGCTTGTTGTCAAATCCGATAATTCGGA
CGAATGAATGTGGGTATTCCTTCTGGACCTCCCCAACCTCCTTCAAAACC
TGGGTTGCATCTGTGCACCCATACATGGGCAGCTTCCACATTGTCCAGTA
GCGTCCATCGTAGTATCCTGGTGAGCTGTGGTGCTCACGGTACACCCATC
CTTTCTGCAGTCACGCCACCCAAAAGAAAAAACAAAAAAAAAAAAAAATC
AAATATCACCACCCATTTGCCTGATAAAATCCGCTTAACCCAAAAGCTTA
AATTTTAAGTAAGCAATTGTTAATGCAGGTTTTGATATTGAATGGATATC
TCTGACCAATAAATTCATGACATGTGTAATTTTTCTCCTAAAGCACATAA
ATAAGGTTCCGTCAAAATAATAGTATATATTAAGAGAGACAGAGAGAGAG
AGAGAGAGAGAGAGAAATGACCTCCAACTCAAATTCCAAGCAGGAAATCC
AGCCGGAGCGGAGAAGGTAACTGATTTCCTTGAGCAAAGCTTCATCGGAC
AGTGGCGGGAGGT
back to top