DT214565

Overview
NameDT214565
Unique NameDT214565
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length713
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DT214565_ssr591 microsatellite DT214565_ssr591:591..614. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig7552 contig Csv1_Contig7552:60..774. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS0_SOLTU (Ribulose bisphosphate carboxylase small chain C, chloroplastic OS=Solanum tuberosum GN=RBCS-C PE=2 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 1.414e-29
Identity = 56/76 (73.68%), Postives = 65/76 (85.53%), Query Frame = -3
Query:  130 QKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 357
            + G+VYREH+SSPGYYDGRYWTMWKLPM+GCTD TQVL EV E +  YP +++RIIGFDN RQVQCISF+A KP G
Sbjct:  105 EHGFVYREHNSSPGYYDGRYWTMWKLPMFGCTDGTQVLAEVQEAKNAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 180          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS7_FLAPR (Ribulose bisphosphate carboxylase small chain 7, chloroplastic OS=Flaveria pringlei GN=RBCS7 PE=2 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 1.847e-29
Identity = 55/77 (71.43%), Postives = 68/77 (88.31%), Query Frame = -3
Query:  130 LQKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 360
            L+ G+VYRE+  SPGYYDGRYWTMWKLPM+GCTD+ QV+KE+ E +KEYP +++RIIGFDN RQVQCISF+A+KP G
Sbjct:   96 LEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDSAQVMKELQECKKEYPQAWIRIIGFDNVRQVQCISFIASKPDG 172          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS5_FLAPR (Ribulose bisphosphate carboxylase small chain 5, chloroplastic OS=Flaveria pringlei GN=RBCS5 PE=2 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 1.847e-29
Identity = 55/77 (71.43%), Postives = 68/77 (88.31%), Query Frame = -3
Query:  130 LQKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 360
            L+ G+VYRE+  SPGYYDGRYWTMWKLPM+GCTD+ QV+KE+ E +KEYP +++RIIGFDN RQVQCISF+A+KP G
Sbjct:   96 LEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDSAQVMKELQECKKEYPQAWIRIIGFDNVRQVQCISFIASKPDG 172          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS4_FLAPR (Ribulose bisphosphate carboxylase small chain 4, chloroplastic OS=Flaveria pringlei GN=RBCS4 PE=2 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 1.847e-29
Identity = 55/77 (71.43%), Postives = 68/77 (88.31%), Query Frame = -3
Query:  130 LQKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 360
            L+ G+VYRE+  SPGYYDGRYWTMWKLPM+GCTD+ QV+KE+ E +KEYP +++RIIGFDN RQVQCISF+A+KP G
Sbjct:  101 LEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDSAQVMKELQECKKEYPQAWIRIIGFDNVRQVQCISFIASKPDG 177          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS3_FLAPR (Ribulose bisphosphate carboxylase small chain 3, chloroplastic OS=Flaveria pringlei GN=RBCS3 PE=2 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 1.847e-29
Identity = 55/77 (71.43%), Postives = 68/77 (88.31%), Query Frame = -3
Query:  130 LQKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 360
            L+ G+VYRE+  SPGYYDGRYWTMWKLPM+GCTD+ QV+KE+ E +KEYP +++RIIGFDN RQVQCISF+A+KP G
Sbjct:   96 LEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDSAQVMKELQECKKEYPQAWIRIIGFDNVRQVQCISFIASKPDG 172          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS2_FLAPR (Ribulose bisphosphate carboxylase small chain 2, chloroplastic OS=Flaveria pringlei GN=RBCS2 PE=2 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 1.847e-29
Identity = 55/77 (71.43%), Postives = 68/77 (88.31%), Query Frame = -3
Query:  130 LQKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 360
            L+ G+VYRE+  SPGYYDGRYWTMWKLPM+GCTD+ QV+KE+ E +KEYP +++RIIGFDN RQVQCISF+A+KP G
Sbjct:  101 LEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDSAQVMKELQECKKEYPQAWIRIIGFDNVRQVQCISFIASKPEG 177          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS2A_SOLLC (Ribulose bisphosphate carboxylase small chain 2A, chloroplastic OS=Solanum lycopersicum GN=RBCS-2A PE=2 SV=2)

HSP 1 Score: 129.413 bits (324), Expect = 1.847e-29
Identity = 57/76 (75.00%), Postives = 66/76 (86.84%), Query Frame = -3
Query:  130 QKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 357
            + G+VYRE++ SPGYYDGRYWTMWKLPM+GCTDATQVL EV E +K YP ++VRIIGFDN RQVQCISF+A KP G
Sbjct:  104 EHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAWVRIIGFDNVRQVQCISFIAYKPEG 179          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS1_LEMGI (Ribulose bisphosphate carboxylase small chain SSU1, chloroplastic OS=Lemna gibba GN=SSU1 PE=2 SV=2)

HSP 1 Score: 129.413 bits (324), Expect = 1.847e-29
Identity = 56/74 (75.68%), Postives = 67/74 (90.54%), Query Frame = -3
Query:  136 QKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKP 357
            ++G+VYRE+++SPGYYDGRYWTMWKLPM+GCTDA+QV+ EV E +K YP  FVRIIGFDNKRQVQCISF+A KP
Sbjct:   99 KEGFVYRENNASPGYYDGRYWTMWKLPMFGCTDASQVIAEVEEAKKAYPEYFVRIIGFDNKRQVQCISFIAYKP 172          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS_ZANAE (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Zantedeschia aethiopica GN=RBCS PE=2 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 2.413e-29
Identity = 57/74 (77.03%), Postives = 63/74 (85.14%), Query Frame = -3
Query:  130 GWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 351
            G+VYRE+H+SPGYYDGRYWTMWKLPM+GCTD++QVLKEV E  K YP  F RIIGFDN RQVQCISFL  KP G
Sbjct:  104 GFVYREYHNSPGYYDGRYWTMWKLPMFGCTDSSQVLKEVDECSKAYPDYFNRIIGFDNTRQVQCISFLTYKPEG 177          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS_TOBAC (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Nicotiana tabacum GN=RBCS PE=1 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 2.413e-29
Identity = 56/76 (73.68%), Postives = 66/76 (86.84%), Query Frame = -3
Query:  130 QKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 357
            + G+VYRE++ SPGYYDGRYWTMWKLPM+GCTDATQVL EV E +K YP +++RIIGFDN RQVQCISF+A KP G
Sbjct:  104 EHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 179          
The following BLAST results are available for this feature:
BLAST of DT214565 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 111
Match NameE-valueIdentityDescription
RBS0_SOLTU1.414e-2973.68Ribulose bisphosphate carboxylase small chain C, c... [more]
RBS7_FLAPR1.847e-2971.43Ribulose bisphosphate carboxylase small chain 7, c... [more]
RBS5_FLAPR1.847e-2971.43Ribulose bisphosphate carboxylase small chain 5, c... [more]
RBS4_FLAPR1.847e-2971.43Ribulose bisphosphate carboxylase small chain 4, c... [more]
RBS3_FLAPR1.847e-2971.43Ribulose bisphosphate carboxylase small chain 3, c... [more]
RBS2_FLAPR1.847e-2971.43Ribulose bisphosphate carboxylase small chain 2, c... [more]
RBS2A_SOLLC1.847e-2975.00Ribulose bisphosphate carboxylase small chain 2A, ... [more]
RBS1_LEMGI1.847e-2975.68Ribulose bisphosphate carboxylase small chain SSU1... [more]
RBS_ZANAE2.413e-2977.03Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS_TOBAC2.413e-2973.68Ribulose bisphosphate carboxylase small chain, chl... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS10_22B11_b2 Madame Vinous Sweet Orange Multiple Pathogen-Infected cDNA Library UCRCS10-2 Citrus sinensis cDNA clone UCRCS10-22B11-C22-5.d-polyt, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DT214565 ID=DT214565|Name=DT214565|organism=Citrus sinensis|type=EST|length=713bp
ACAGCAGCCTAAGTAAAATTAAACGCAAACCGAACCCCCATTGATCGAAT
GATCATTATGGGGGTTACACATAATAATAATCAACAATATTGCATGGGTG
GTTACACAAATTTAATTGGGAACCTAGACGCCTGGTGGCTTGGCAGCAAG
GAAACTGATGCACTGCACTTGACGCTTGTTGTCAAATCCGATAATTCGGA
CGAATGAATGTGGGTATTCCTTCTGGACCTCCCCAACCTCCTTCAAAACC
TGGGTTGCATCTGTGCACCCATACATGGGCAGCTTCCACATTGTCCAGTA
GCGTCCATCGTAGTATCCTGGTGAGCTGTGGTGCTCACGGTACACCCATC
CTTTCTGCAGTCACGCCACCCAAAAGAAAAAACAAAAAAAAAAAAAAATC
AAATATCACCACCCATTTGCCTGATAAAATCCGCTTAACCCAAAAGCTTA
AATTTTAAGTAAGCAATTGTTAATGCAGGTTTTGATATTGAATGGATATC
TCTGACCAATAAATTCATGACATGTGTAATTTTTCTCCTAAAGCACATAA
ATAAGGTTCCGTCAAAATAATAGTATATATTAAGAGAGACAGAGAGAGAG
AGAGAGAGAGAGAGAAATGACCTCCAACTCAAATTCCAAGCAGGAAATCC
AGCCGGAGCGGAGAAGGTAACTGATTTCCTTGAGCAAAGCTTCATCGGAC
AGTGGCGGGAGGT
back to top