DT214565

Overview
NameDT214565
Unique NameDT214565
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length713
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DT214565_ssr591 microsatellite DT214565_ssr591:591..614. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig7552 contig Csv1_Contig7552:60..774. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBSC_SOLTU (Ribulose bisphosphate carboxylase small chain 2C, chloroplastic OS=Solanum tuberosum GN=RBCS-2C PE=3 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 2.413e-29
Identity = 56/76 (73.68%), Postives = 66/76 (86.84%), Query Frame = -3
Query:  130 QKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 357
            + G+VYRE++ SPGYYDGRYWTMWKLPM+GCTDATQVL EV E +K YP +++RIIGFDN RQVQCISF+A KP G
Sbjct:  104 EHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 179          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBSB_SOLTU (Ribulose bisphosphate carboxylase small chain 2B, chloroplastic OS=Solanum tuberosum GN=RBCS-2B PE=3 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 2.413e-29
Identity = 56/76 (73.68%), Postives = 66/76 (86.84%), Query Frame = -3
Query:  130 QKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 357
            + G+VYRE++ SPGYYDGRYWTMWKLPM+GCTDATQVL EV E +K YP +++RIIGFDN RQVQCISF+A KP G
Sbjct:  104 EHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 179          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBSA_SOLTU (Ribulose bisphosphate carboxylase small chain 2A, chloroplastic OS=Solanum tuberosum GN=RBCS-2A PE=3 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 2.413e-29
Identity = 56/76 (73.68%), Postives = 66/76 (86.84%), Query Frame = -3
Query:  130 QKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 357
            + G+VYRE++ SPGYYDGRYWTMWKLPM+GCTDATQVL EV E +K YP +++RIIGFDN RQVQCISF+A KP G
Sbjct:  104 EHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 179          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS4_SOYBN (Ribulose bisphosphate carboxylase small chain 4, chloroplastic OS=Glycine max GN=RBCS-4 PE=3 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 2.413e-29
Identity = 56/76 (73.68%), Postives = 66/76 (86.84%), Query Frame = -3
Query:  133 LQKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPP 360
            L+ G+VYREH+ S GYYDGRYWTMWKLPM+GCTDA+QVLKE+ E +  YP+ F+RIIGFDN RQVQCISF+A KPP
Sbjct:  101 LEHGFVYREHNRSLGYYDGRYWTMWKLPMFGCTDASQVLKELQEAKTAYPNGFIRIIGFDNVRQVQCISFIAYKPP 176          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS2_NICSY (Ribulose bisphosphate carboxylase small chain S41, chloroplastic OS=Nicotiana sylvestris PE=3 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 2.413e-29
Identity = 56/76 (73.68%), Postives = 66/76 (86.84%), Query Frame = -3
Query:  130 QKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 357
            + G+VYRE++ SPGYYDGRYWTMWKLPM+GCTDATQVL EV E +K YP +++RIIGFDN RQVQCISF+A KP G
Sbjct:  105 EHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 180          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS1_NICSY (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Nicotiana sylvestris GN=RBCS PE=2 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 2.413e-29
Identity = 56/76 (73.68%), Postives = 66/76 (86.84%), Query Frame = -3
Query:  130 QKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 357
            + G+VYRE++ SPGYYDGRYWTMWKLPM+GCTDATQVL EV E +K YP +++RIIGFDN RQVQCISF+A KP G
Sbjct:  104 EHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 179          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS1_FLAPR (Ribulose bisphosphate carboxylase small chain 1, chloroplastic OS=Flaveria pringlei GN=RBCS1 PE=2 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 2.413e-29
Identity = 55/77 (71.43%), Postives = 68/77 (88.31%), Query Frame = -3
Query:  130 LQKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 360
            L+ G+VYRE+  SPGYYDGRYWTMWKLPM+GCTD+ QV+KE+ E +KEYP +++RIIGFDN RQVQCISF+A+KP G
Sbjct:   96 LEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDSAQVMKELQECKKEYPQAWIRIIGFDNVRQVQCISFIASKPGG 172          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS1_AMAHP (Ribulose bisphosphate carboxylase small chain 1, chloroplastic OS=Amaranthus hypochondriacus GN=RBCS1 PE=2 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 3.151e-29
Identity = 56/77 (72.73%), Postives = 64/77 (83.12%), Query Frame = -3
Query:  130 LQKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 360
            L+  +VYRE+H SPGY DGRYWTMWKLPMYGCTD  QVL EV E +K YP +F+RIIGFDNKRQVQC+SF+A KP G
Sbjct:  105 LEHPFVYRENHRSPGYQDGRYWTMWKLPMYGCTDPAQVLNEVEEAKKAYPSAFIRIIGFDNKRQVQCVSFIAYKPAG 181          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS_MANES (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Manihot esculenta PE=2 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 5.375e-29
Identity = 57/77 (74.03%), Postives = 63/77 (81.82%), Query Frame = -3
Query:  130 LQKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 360
            L+ G VYREH   PGYYDGRYWTMWKLPM+GCTDA QVLKE+ E+ K +P  + RIIGFDN RQVQCISFLA KPPG
Sbjct:  105 LEHGLVYREHARVPGYYDGRYWTMWKLPMFGCTDAAQVLKELDELIKHHPDGYARIIGFDNVRQVQCISFLAYKPPG 181          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS_CUCSA (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Cucumis sativus GN=RBCS PE=2 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 5.375e-29
Identity = 52/72 (72.22%), Postives = 66/72 (91.67%), Query Frame = -3
Query:  136 GWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKP 351
            G+VYRE+H SPG+YDGRYWTMWKLPM+GCTD++QV++E+ E +KEYP +F+R+IGFDN RQVQCISF+A KP
Sbjct:  108 GFVYRENHRSPGFYDGRYWTMWKLPMFGCTDSSQVIQEIEEAKKEYPDAFIRVIGFDNVRQVQCISFIAYKP 179          
The following BLAST results are available for this feature:
BLAST of DT214565 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 111
Match NameE-valueIdentityDescription
RBSC_SOLTU2.413e-2973.68Ribulose bisphosphate carboxylase small chain 2C, ... [more]
RBSB_SOLTU2.413e-2973.68Ribulose bisphosphate carboxylase small chain 2B, ... [more]
RBSA_SOLTU2.413e-2973.68Ribulose bisphosphate carboxylase small chain 2A, ... [more]
RBS4_SOYBN2.413e-2973.68Ribulose bisphosphate carboxylase small chain 4, c... [more]
RBS2_NICSY2.413e-2973.68Ribulose bisphosphate carboxylase small chain S41,... [more]
RBS1_NICSY2.413e-2973.68Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS1_FLAPR2.413e-2971.43Ribulose bisphosphate carboxylase small chain 1, c... [more]
RBS1_AMAHP3.151e-2972.73Ribulose bisphosphate carboxylase small chain 1, c... [more]
RBS_MANES5.375e-2974.03Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS_CUCSA5.375e-2972.22Ribulose bisphosphate carboxylase small chain, chl... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS10_22B11_b2 Madame Vinous Sweet Orange Multiple Pathogen-Infected cDNA Library UCRCS10-2 Citrus sinensis cDNA clone UCRCS10-22B11-C22-5.d-polyt, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DT214565 ID=DT214565|Name=DT214565|organism=Citrus sinensis|type=EST|length=713bp
ACAGCAGCCTAAGTAAAATTAAACGCAAACCGAACCCCCATTGATCGAAT
GATCATTATGGGGGTTACACATAATAATAATCAACAATATTGCATGGGTG
GTTACACAAATTTAATTGGGAACCTAGACGCCTGGTGGCTTGGCAGCAAG
GAAACTGATGCACTGCACTTGACGCTTGTTGTCAAATCCGATAATTCGGA
CGAATGAATGTGGGTATTCCTTCTGGACCTCCCCAACCTCCTTCAAAACC
TGGGTTGCATCTGTGCACCCATACATGGGCAGCTTCCACATTGTCCAGTA
GCGTCCATCGTAGTATCCTGGTGAGCTGTGGTGCTCACGGTACACCCATC
CTTTCTGCAGTCACGCCACCCAAAAGAAAAAACAAAAAAAAAAAAAAATC
AAATATCACCACCCATTTGCCTGATAAAATCCGCTTAACCCAAAAGCTTA
AATTTTAAGTAAGCAATTGTTAATGCAGGTTTTGATATTGAATGGATATC
TCTGACCAATAAATTCATGACATGTGTAATTTTTCTCCTAAAGCACATAA
ATAAGGTTCCGTCAAAATAATAGTATATATTAAGAGAGACAGAGAGAGAG
AGAGAGAGAGAGAGAAATGACCTCCAACTCAAATTCCAAGCAGGAAATCC
AGCCGGAGCGGAGAAGGTAACTGATTTCCTTGAGCAAAGCTTCATCGGAC
AGTGGCGGGAGGT
back to top