DT214565

Overview
NameDT214565
Unique NameDT214565
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length713
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DT214565_ssr591 microsatellite DT214565_ssr591:591..614. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig7552 contig Csv1_Contig7552:60..774. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS3_PEA (Ribulose bisphosphate carboxylase small chain 3A, chloroplastic OS=Pisum sativum GN=RBCS-3A PE=3 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 5.375e-29
Identity = 57/75 (76.00%), Postives = 65/75 (86.67%), Query Frame = -3
Query:  136 LQKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKP 360
            L+KG+VYREH+ SPGYYDGRYWTMWKLPM+G TDA+QVLKE+ EV   YP +FVRIIGFDN RQVQCISF+A  P
Sbjct:  103 LEKGFVYREHNKSPGYYDGRYWTMWKLPMFGTTDASQVLKELDEVVAAYPQAFVRIIGFDNVRQVQCISFIAHTP 177          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS2_PEA (Ribulose bisphosphate carboxylase small chain 3C, chloroplastic OS=Pisum sativum GN=RBCS-3C PE=2 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 5.375e-29
Identity = 57/75 (76.00%), Postives = 65/75 (86.67%), Query Frame = -3
Query:  136 LQKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKP 360
            L+KG+VYREH+ SPGYYDGRYWTMWKLPM+G TDA+QVLKE+ EV   YP +FVRIIGFDN RQVQCISF+A  P
Sbjct:  103 LEKGFVYREHNKSPGYYDGRYWTMWKLPMFGTTDASQVLKELDEVVAAYPQAFVRIIGFDNVRQVQCISFIAHTP 177          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS6_FLAPR (Ribulose bisphosphate carboxylase small chain 6, chloroplastic OS=Flaveria pringlei GN=RBCS6 PE=2 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 7.020e-29
Identity = 54/75 (72.00%), Postives = 67/75 (89.33%), Query Frame = -3
Query:  136 LQKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKP 360
            L+ G+VYRE+  SPGYYDGRYWTMWKLPM+GCTD+ QV+KE+ E +KEYP +++RIIGFDN RQVQCISF+A+KP
Sbjct:   96 LEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDSVQVMKELQECKKEYPQAWIRIIGFDNVRQVQCISFIASKP 170          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS_STELP (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Stellaria longipes GN=RBCS PE=2 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 9.168e-29
Identity = 56/74 (75.68%), Postives = 63/74 (85.14%), Query Frame = -3
Query:  136 QKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKP 357
            + G+VYREH SSPGYYDGRYWTMWKLPM+GCTDATQV  EV E +K YP + +RIIGFDN RQVQCISF+A KP
Sbjct:  104 EHGFVYREHTSSPGYYDGRYWTMWKLPMFGCTDATQVAAEVQEAKKAYPDAHIRIIGFDNVRQVQCISFIAYKP 177          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS_HEVBR (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Hevea brasiliensis GN=RBCS PE=2 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 9.168e-29
Identity = 57/77 (74.03%), Postives = 64/77 (83.12%), Query Frame = -3
Query:  130 LQKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 360
            L+ G VYRE+H SPGYYDGRYWTMWKLPM+GCTDA QVL+E+ E+ K YP  + RIIGFDN RQVQCISFLA KP G
Sbjct:  105 LEHGTVYREYHRSPGYYDGRYWTMWKLPMFGCTDAVQVLQELDEMIKAYPDCYGRIIGFDNVRQVQCISFLAYKPKG 181          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS_HELAN (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Helianthus annuus GN=RBCS PE=2 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 9.168e-29
Identity = 53/77 (68.83%), Postives = 67/77 (87.01%), Query Frame = -3
Query:  130 LQKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 360
            L+ G+VYRE+  SPGYYDGRYWTMWKLPM+GCTD+ QV+KE+ E +KEYP +++RIIGFDN RQVQCI F+A++P G
Sbjct:  101 LEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDSAQVMKELAECKKEYPQAWIRIIGFDNVRQVQCIMFIASRPDG 177          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS_FAGCR (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Fagus crenata GN=RBCS1 PE=2 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 1.197e-28
Identity = 56/76 (73.68%), Postives = 64/76 (84.21%), Query Frame = -3
Query:  133 LQKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPP 360
            L+  +VYRE++ SPGYYDGRYW MWKLPM+GCTDATQVL E+ E  K YP S +RIIGFDNKRQVQCISF+A KPP
Sbjct:  105 LEHPFVYRENNRSPGYYDGRYWVMWKLPMFGCTDATQVLAELQEASKTYPTSHIRIIGFDNKRQVQCISFIAYKPP 180          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS2_AMAHP (Ribulose bisphosphate carboxylase small chain 2, chloroplastic OS=Amaranthus hypochondriacus GN=RBCS2 PE=2 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 1.564e-28
Identity = 55/75 (73.33%), Postives = 63/75 (84.00%), Query Frame = -3
Query:  136 LQKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKP 360
            L+  +VYRE+H SPGY DGRYWTMWKLPMYGCTD  QVL EV E +K YP +F+RIIGFDNKRQVQC+SF+A KP
Sbjct:  106 LEHPFVYRENHRSPGYQDGRYWTMWKLPMYGCTDPAQVLNEVEEAKKAYPTAFIRIIGFDNKRQVQCVSFIAYKP 180          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS_MEDSA (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Medicago sativa PE=2 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 2.668e-28
Identity = 53/75 (70.67%), Postives = 66/75 (88.00%), Query Frame = -3
Query:  136 LQKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKP 360
            L+KG+VYRE+H SPGYYDGRYWTMW+LP++G TD++QVLKE+ + + EYP SF+RIIGFDN RQVQCISF+A  P
Sbjct:  103 LEKGFVYRENHRSPGYYDGRYWTMWRLPLFGATDSSQVLKELADCKAEYPDSFIRIIGFDNVRQVQCISFIAHTP 177          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS_TRIRP (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Trifolium repens GN=RBCS PE=3 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 3.484e-28
Identity = 53/75 (70.67%), Postives = 67/75 (89.33%), Query Frame = -3
Query:  136 LQKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKP 360
            L+KG+V+R+++SSPGYYDGRYWTMW+LP++G TDA QVLKEV E + EYP +F+RIIGFDN RQVQCISF+A+ P
Sbjct:  101 LEKGFVHRQYNSSPGYYDGRYWTMWRLPLFGTTDAAQVLKEVAECKAEYPEAFIRIIGFDNVRQVQCISFIASTP 175          
The following BLAST results are available for this feature:
BLAST of DT214565 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 111
Match NameE-valueIdentityDescription
RBS3_PEA5.375e-2976.00Ribulose bisphosphate carboxylase small chain 3A, ... [more]
RBS2_PEA5.375e-2976.00Ribulose bisphosphate carboxylase small chain 3C, ... [more]
RBS6_FLAPR7.020e-2972.00Ribulose bisphosphate carboxylase small chain 6, c... [more]
RBS_STELP9.168e-2975.68Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS_HEVBR9.168e-2974.03Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS_HELAN9.168e-2968.83Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS_FAGCR1.197e-2873.68Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS2_AMAHP1.564e-2873.33Ribulose bisphosphate carboxylase small chain 2, c... [more]
RBS_MEDSA2.668e-2870.67Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS_TRIRP3.484e-2870.67Ribulose bisphosphate carboxylase small chain, chl... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS10_22B11_b2 Madame Vinous Sweet Orange Multiple Pathogen-Infected cDNA Library UCRCS10-2 Citrus sinensis cDNA clone UCRCS10-22B11-C22-5.d-polyt, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DT214565 ID=DT214565|Name=DT214565|organism=Citrus sinensis|type=EST|length=713bp
ACAGCAGCCTAAGTAAAATTAAACGCAAACCGAACCCCCATTGATCGAAT
GATCATTATGGGGGTTACACATAATAATAATCAACAATATTGCATGGGTG
GTTACACAAATTTAATTGGGAACCTAGACGCCTGGTGGCTTGGCAGCAAG
GAAACTGATGCACTGCACTTGACGCTTGTTGTCAAATCCGATAATTCGGA
CGAATGAATGTGGGTATTCCTTCTGGACCTCCCCAACCTCCTTCAAAACC
TGGGTTGCATCTGTGCACCCATACATGGGCAGCTTCCACATTGTCCAGTA
GCGTCCATCGTAGTATCCTGGTGAGCTGTGGTGCTCACGGTACACCCATC
CTTTCTGCAGTCACGCCACCCAAAAGAAAAAACAAAAAAAAAAAAAAATC
AAATATCACCACCCATTTGCCTGATAAAATCCGCTTAACCCAAAAGCTTA
AATTTTAAGTAAGCAATTGTTAATGCAGGTTTTGATATTGAATGGATATC
TCTGACCAATAAATTCATGACATGTGTAATTTTTCTCCTAAAGCACATAA
ATAAGGTTCCGTCAAAATAATAGTATATATTAAGAGAGACAGAGAGAGAG
AGAGAGAGAGAGAGAAATGACCTCCAACTCAAATTCCAAGCAGGAAATCC
AGCCGGAGCGGAGAAGGTAACTGATTTCCTTGAGCAAAGCTTCATCGGAC
AGTGGCGGGAGGT
back to top