DT214565

Overview
NameDT214565
Unique NameDT214565
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length713
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DT214565_ssr591 microsatellite DT214565_ssr591:591..614. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig7552 contig Csv1_Contig7552:60..774. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS3_MESCR (Ribulose bisphosphate carboxylase small chain 3, chloroplastic OS=Mesembryanthemum crystallinum GN=RBCS-3 PE=2 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 1.014e-27
Identity = 52/72 (72.22%), Postives = 63/72 (87.50%), Query Frame = -3
Query:  136 GWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKP 351
            G+VYREH ++PGYYDGRYWTMWKLPM+GCTD +QV+ E+ E +K YP +F+RIIGFDN RQVQCISF+A KP
Sbjct:  107 GFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPSQVVAELEEAKKAYPEAFIRIIGFDNVRQVQCISFIAYKP 178          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS1_MESCR (Ribulose bisphosphate carboxylase small chain 1, chloroplastic OS=Mesembryanthemum crystallinum GN=RBCS-1 PE=2 SV=2)

HSP 1 Score: 123.635 bits (309), Expect = 1.014e-27
Identity = 52/72 (72.22%), Postives = 63/72 (87.50%), Query Frame = -3
Query:  136 GWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKP 351
            G+VYREH ++PGYYDGRYWTMWKLPM+GCTD +QV+ E+ E +K YP +F+RIIGFDN RQVQCISF+A KP
Sbjct:  106 GFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPSQVVAELEEAKKAYPEAFIRIIGFDNVRQVQCISFIAYKP 177          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS6_MESCR (Ribulose bisphosphate carboxylase small chain 6, chloroplastic OS=Mesembryanthemum crystallinum GN=RBCS-6 PE=3 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 1.324e-27
Identity = 51/72 (70.83%), Postives = 63/72 (87.50%), Query Frame = -3
Query:  136 GWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKP 351
            G+VYREH ++PGYYDGRYWTMWKLPM+GCTD +QV+ E+ E +K YP +F+RIIGFDN RQVQC+SF+A KP
Sbjct:  110 GFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPSQVVAELEEAKKAYPEAFIRIIGFDNVRQVQCVSFIAYKP 181          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS5_MESCR (Ribulose bisphosphate carboxylase small chain 5, chloroplastic OS=Mesembryanthemum crystallinum GN=RBCS-5 PE=3 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 1.324e-27
Identity = 51/72 (70.83%), Postives = 63/72 (87.50%), Query Frame = -3
Query:  136 GWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKP 351
            G+VYREH ++PGYYDGRYWTMWKLPM+GCTD +QV+ E+ E +K YP +F+RIIGFDN RQVQC+SF+A KP
Sbjct:  106 GFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPSQVVAELEEAKKAYPEAFIRIIGFDNVRQVQCVSFIAYKP 177          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS4_MESCR (Ribulose bisphosphate carboxylase small chain 4, chloroplastic OS=Mesembryanthemum crystallinum GN=RBCS-4 PE=2 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 1.324e-27
Identity = 51/72 (70.83%), Postives = 63/72 (87.50%), Query Frame = -3
Query:  136 GWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKP 351
            G+VYREH ++PGYYDGRYWTMWKLPM+GCTD +QV+ E+ E +K YP +F+RIIGFDN RQVQC+SF+A KP
Sbjct:  107 GFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPSQVVAELEEAKKAYPEAFIRIIGFDNVRQVQCVSFIAYKP 178          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS_AEGTA (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Aegilops tauschii GN=RBCS PE=2 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 1.729e-27
Identity = 52/74 (70.27%), Postives = 63/74 (85.14%), Query Frame = -3
Query:  130 GWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 351
            G+++REH+ SPGYYDGRYWTMWKLPM+GC   TQV+ EV EV+KEYP  + RIIGFDN RQVQ +SF+A+KPPG
Sbjct:   95 GFIFREHNVSPGYYDGRYWTMWKLPMFGCPAPTQVIPEVEEVRKEYPDPYCRIIGFDNMRQVQSVSFIASKPPG 168          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS3_FRIAG (Ribulose bisphosphate carboxylase small chain 3, chloroplastic OS=Fritillaria agrestis GN=RBCS3 PE=2 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 1.729e-27
Identity = 53/82 (64.63%), Postives = 67/82 (81.71%), Query Frame = -3
Query:  136 WVA*LQ---KGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKP 372
            WV  L+   +G+V R+++ SPGYYDGRYWTMWKLPM+GCTDA QV+KE  E +KEYP +F+R+IGFDN RQVQC+SF+  KP
Sbjct:   97 WVPCLEFSLEGFVSRDNNKSPGYYDGRYWTMWKLPMFGCTDAAQVVKEAAECKKEYPAAFIRVIGFDNVRQVQCVSFIVEKP 178          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS2_FRIAG (Ribulose bisphosphate carboxylase small chain 2, chloroplastic OS=Fritillaria agrestis GN=RBCS2 PE=2 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 1.729e-27
Identity = 53/82 (64.63%), Postives = 67/82 (81.71%), Query Frame = -3
Query:  136 WVA*LQ---KGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKP 372
            WV  L+   +G+V R+++ SPGYYDGRYWTMWKLPM+GCTDA QV+KE  E +KEYP +F+R+IGFDN RQVQC+SF+  KP
Sbjct:   97 WVPCLEFSLEGFVSRDNNKSPGYYDGRYWTMWKLPMFGCTDAAQVVKEAAECKKEYPAAFIRVIGFDNVRQVQCVSFIVEKP 178          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS_GOSHI (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Gossypium hirsutum GN=RBCS PE=3 SV=2)

HSP 1 Score: 122.479 bits (306), Expect = 2.258e-27
Identity = 52/77 (67.53%), Postives = 67/77 (87.01%), Query Frame = -3
Query:  130 LQKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 360
            L++G+V+R++ S P YYDGRYWTMWKLPM+GCTD+ QVL+E+   +KEYP++F+RIIGFDN RQVQCISF+A KP G
Sbjct:  105 LEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLEELENCKKEYPNAFIRIIGFDNVRQVQCISFIAYKPKG 181          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS2_MESCR (Ribulose bisphosphate carboxylase small chain 2, chloroplastic OS=Mesembryanthemum crystallinum GN=RBCS-2 PE=2 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 2.258e-27
Identity = 52/72 (72.22%), Postives = 62/72 (86.11%), Query Frame = -3
Query:  136 GWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKP 351
            G+VYREH ++PGYYDGRYWTMWKLPM+GCTD +QV+ E+ E +K YP +F RIIGFDN RQVQCISF+A KP
Sbjct:  104 GFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPSQVVAELEEAKKAYPEAFTRIIGFDNVRQVQCISFIAYKP 175          
The following BLAST results are available for this feature:
BLAST of DT214565 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 111
Match NameE-valueIdentityDescription
RBS3_MESCR1.014e-2772.22Ribulose bisphosphate carboxylase small chain 3, c... [more]
RBS1_MESCR1.014e-2772.22Ribulose bisphosphate carboxylase small chain 1, c... [more]
RBS6_MESCR1.324e-2770.83Ribulose bisphosphate carboxylase small chain 6, c... [more]
RBS5_MESCR1.324e-2770.83Ribulose bisphosphate carboxylase small chain 5, c... [more]
RBS4_MESCR1.324e-2770.83Ribulose bisphosphate carboxylase small chain 4, c... [more]
RBS_AEGTA1.729e-2770.27Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS3_FRIAG1.729e-2764.63Ribulose bisphosphate carboxylase small chain 3, c... [more]
RBS2_FRIAG1.729e-2764.63Ribulose bisphosphate carboxylase small chain 2, c... [more]
RBS_GOSHI2.258e-2767.53Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS2_MESCR2.258e-2772.22Ribulose bisphosphate carboxylase small chain 2, c... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS10_22B11_b2 Madame Vinous Sweet Orange Multiple Pathogen-Infected cDNA Library UCRCS10-2 Citrus sinensis cDNA clone UCRCS10-22B11-C22-5.d-polyt, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DT214565 ID=DT214565|Name=DT214565|organism=Citrus sinensis|type=EST|length=713bp
ACAGCAGCCTAAGTAAAATTAAACGCAAACCGAACCCCCATTGATCGAAT
GATCATTATGGGGGTTACACATAATAATAATCAACAATATTGCATGGGTG
GTTACACAAATTTAATTGGGAACCTAGACGCCTGGTGGCTTGGCAGCAAG
GAAACTGATGCACTGCACTTGACGCTTGTTGTCAAATCCGATAATTCGGA
CGAATGAATGTGGGTATTCCTTCTGGACCTCCCCAACCTCCTTCAAAACC
TGGGTTGCATCTGTGCACCCATACATGGGCAGCTTCCACATTGTCCAGTA
GCGTCCATCGTAGTATCCTGGTGAGCTGTGGTGCTCACGGTACACCCATC
CTTTCTGCAGTCACGCCACCCAAAAGAAAAAACAAAAAAAAAAAAAAATC
AAATATCACCACCCATTTGCCTGATAAAATCCGCTTAACCCAAAAGCTTA
AATTTTAAGTAAGCAATTGTTAATGCAGGTTTTGATATTGAATGGATATC
TCTGACCAATAAATTCATGACATGTGTAATTTTTCTCCTAAAGCACATAA
ATAAGGTTCCGTCAAAATAATAGTATATATTAAGAGAGACAGAGAGAGAG
AGAGAGAGAGAGAGAAATGACCTCCAACTCAAATTCCAAGCAGGAAATCC
AGCCGGAGCGGAGAAGGTAACTGATTTCCTTGAGCAAAGCTTCATCGGAC
AGTGGCGGGAGGT
back to top