DT214565

Overview
NameDT214565
Unique NameDT214565
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length713
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DT214565_ssr591 microsatellite DT214565_ssr591:591..614. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig7552 contig Csv1_Contig7552:60..774. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS1_FRIAG (Ribulose bisphosphate carboxylase small chain 1/4, chloroplastic OS=Fritillaria agrestis GN=RBCS1 PE=2 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 3.852e-27
Identity = 52/82 (63.41%), Postives = 67/82 (81.71%), Query Frame = -3
Query:  136 WVA*LQ---KGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKP 372
            WV  L+   +G+V R+++ SPGYYDGRYWTMWKLPM+GCTDA QV+KE  E +KEYP +F+R+IGFDN RQVQC+SF+  +P
Sbjct:   97 WVPCLEFSLEGFVSRDNNKSPGYYDGRYWTMWKLPMFGCTDAAQVVKEAAECKKEYPAAFIRVIGFDNVRQVQCVSFIVERP 178          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS5_FRIAG (Ribulose bisphosphate carboxylase small chain 5, chloroplastic OS=Fritillaria agrestis GN=RBCS5 PE=2 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 1.121e-26
Identity = 52/82 (63.41%), Postives = 66/82 (80.49%), Query Frame = -3
Query:  136 WVA*LQ---KGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKP 372
            WV  L+   +G+V R+++ SPGYYDGRYWTMWKLPM+GCT A QV+KE  E +KEYP +F+R+IGFDN RQVQC+SF+  KP
Sbjct:   97 WVPCLEFSLEGFVSRDNNKSPGYYDGRYWTMWKLPMFGCTGAAQVVKEAAECKKEYPAAFIRVIGFDNVRQVQCVSFIVEKP 178          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS_SILPR (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Silene pratensis GN=RBCS PE=2 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 1.464e-26
Identity = 53/70 (75.71%), Postives = 60/70 (85.71%), Query Frame = -3
Query:  136 VYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKP 345
            VYRE++ SPGYYDGRYWTMWKLPM+GCTDA+QV  EV E +  YP + VRIIGFDNKRQVQCISF+A KP
Sbjct:  107 VYRENNKSPGYYDGRYWTMWKLPMFGCTDASQVAAEVVECKNAYPDAHVRIIGFDNKRQVQCISFIAYKP 176          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS_MAIZE (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Zea mays GN=RBCS PE=1 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 1.912e-26
Identity = 51/74 (68.92%), Postives = 61/74 (82.43%), Query Frame = -3
Query:  130 GWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 351
            G+VYRE+ +SP YYDGRYWTMWKLPM+GC DATQV KE+ E  K YP +F R+IGFDN +Q QC+SF+A KPPG
Sbjct:   95 GFVYRENSTSPCYYDGRYWTMWKLPMFGCNDATQVYKELQEAIKSYPDAFHRVIGFDNIKQTQCVSFIAYKPPG 168          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS1_SPIOL (Ribulose bisphosphate carboxylase small chain OS=Spinacia oleracea GN=RBCS PE=1 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 7.265e-26
Identity = 52/77 (67.53%), Postives = 63/77 (81.82%), Query Frame = -3
Query:  130 LQKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 360
            ++ G+VYREH  SPGYYDGRYWTMWKLPM+G TD  QV+ EV EV+K  P +FVR IGF++KR+VQCISF+A KP G
Sbjct:   46 VKDGFVYREHDKSPGYYDGRYWTMWKLPMFGGTDPAQVVNEVEEVKKAPPDAFVRFIGFNDKREVQCISFIAYKPAG 122          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS1_PEA (Ribulose bisphosphate carboxylase small chain, chloroplastic (Fragment) OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 2.114e-25
Identity = 52/75 (69.33%), Postives = 60/75 (80.00%), Query Frame = -3
Query:  136 LQKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKP 360
            L KG+VY EH+ SP YYDGRYWTMWKLPM+G TD  QV+KEV EV   YP +FVR+IGF+N RQVQCISF+A  P
Sbjct:   59 LLKGFVYGEHNKSPRYYDGRYWTMWKLPMFGTTDPAQVVKEVDEVVAAYPEAFVRVIGFNNVRQVQCISFIAHTP 133          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS_PINTH (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Pinus thunbergii GN=RBCS PE=2 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 8.032e-25
Identity = 50/82 (60.98%), Postives = 64/82 (78.05%), Query Frame = -3
Query:  136 WVA*LQ---KGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKP 372
            WV  L+   +G + R+++ SPGYYDGRYW MWKLPM+GCT+A+QV+ EV E  K YP +F+R+IGFDN RQVQCISF+  KP
Sbjct:   89 WVPCLEFDLEGSISRKYNRSPGYYDGRYWVMWKLPMFGCTEASQVINEVRECAKAYPKAFIRVIGFDNVRQVQCISFIVHKP 170          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS_LARLA (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Larix laricina GN=RBCS PE=3 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 8.032e-25
Identity = 48/74 (64.86%), Postives = 60/74 (81.08%), Query Frame = -3
Query:  136 QKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKP 357
            + G + R + +SPGYYDGRYW MWKLPM+GCT+A+QVL EV E  K YP++F+R+IGFDN RQVQCISF+  KP
Sbjct:  113 EDGEIKRVYGNSPGYYDGRYWVMWKLPMFGCTEASQVLNEVNECAKAYPNAFIRVIGFDNVRQVQCISFIVHKP 186          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS_SACHY (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Saccharum hybrid GN=RBCS PE=3 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 5.388e-21
Identity = 49/84 (58.33%), Postives = 61/84 (72.62%), Query Frame = -3
Query:  130 WVA*LQ---KGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 372
            WV  L+   +G+VYRE+ +SP YYDGRYWTMWKLPM+GCTDA+QV KE+ E    YP     I+GFDN RQ Q ++F+A KP G
Sbjct:   84 WVPCLEFSKEGFVYRENSTSPCYYDGRYWTMWKLPMFGCTDASQVYKELQEAIASYP-ELRAILGFDNIRQTQWLTFIAYKPAG 166          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS_MARPA (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Marchantia paleacea GN=RBCS PE=2 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 4.561e-20
Identity = 43/74 (58.11%), Postives = 55/74 (74.32%), Query Frame = -3
Query:  136 KGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEY-PHSFVRIIGFDNKRQVQCISFLAAKP 354
            +G V RE  + PGYYDGRYWTMWKLPM+GCTD+  VL+E+ E +K Y    ++R +GFDN RQVQC SF+  +P
Sbjct:  105 QGTVTREGSTMPGYYDGRYWTMWKLPMFGCTDSASVLREIEECKKLYGKKCYIRCLGFDNTRQVQCASFIVHQP 178          
The following BLAST results are available for this feature:
BLAST of DT214565 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 111
Match NameE-valueIdentityDescription
RBS1_FRIAG3.852e-2763.41Ribulose bisphosphate carboxylase small chain 1/4,... [more]
RBS5_FRIAG1.121e-2663.41Ribulose bisphosphate carboxylase small chain 5, c... [more]
RBS_SILPR1.464e-2675.71Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS_MAIZE1.912e-2668.92Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS1_SPIOL7.265e-2667.53Ribulose bisphosphate carboxylase small chain OS=S... [more]
RBS1_PEA2.114e-2569.33Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS_PINTH8.032e-2560.98Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS_LARLA8.032e-2564.86Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS_SACHY5.388e-2158.33Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS_MARPA4.561e-2058.11Ribulose bisphosphate carboxylase small chain, chl... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS10_22B11_b2 Madame Vinous Sweet Orange Multiple Pathogen-Infected cDNA Library UCRCS10-2 Citrus sinensis cDNA clone UCRCS10-22B11-C22-5.d-polyt, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DT214565 ID=DT214565|Name=DT214565|organism=Citrus sinensis|type=EST|length=713bp
ACAGCAGCCTAAGTAAAATTAAACGCAAACCGAACCCCCATTGATCGAAT
GATCATTATGGGGGTTACACATAATAATAATCAACAATATTGCATGGGTG
GTTACACAAATTTAATTGGGAACCTAGACGCCTGGTGGCTTGGCAGCAAG
GAAACTGATGCACTGCACTTGACGCTTGTTGTCAAATCCGATAATTCGGA
CGAATGAATGTGGGTATTCCTTCTGGACCTCCCCAACCTCCTTCAAAACC
TGGGTTGCATCTGTGCACCCATACATGGGCAGCTTCCACATTGTCCAGTA
GCGTCCATCGTAGTATCCTGGTGAGCTGTGGTGCTCACGGTACACCCATC
CTTTCTGCAGTCACGCCACCCAAAAGAAAAAACAAAAAAAAAAAAAAATC
AAATATCACCACCCATTTGCCTGATAAAATCCGCTTAACCCAAAAGCTTA
AATTTTAAGTAAGCAATTGTTAATGCAGGTTTTGATATTGAATGGATATC
TCTGACCAATAAATTCATGACATGTGTAATTTTTCTCCTAAAGCACATAA
ATAAGGTTCCGTCAAAATAATAGTATATATTAAGAGAGACAGAGAGAGAG
AGAGAGAGAGAGAGAAATGACCTCCAACTCAAATTCCAAGCAGGAAATCC
AGCCGGAGCGGAGAAGGTAACTGATTTCCTTGAGCAAAGCTTCATCGGAC
AGTGGCGGGAGGT
back to top