DT214565

Overview
NameDT214565
Unique NameDT214565
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length713
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DT214565_ssr591 microsatellite DT214565_ssr591:591..614. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig7552 contig Csv1_Contig7552:60..774. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS_EUGGR (Ribulose bisphosphate carboxylase small chains, chloroplastic OS=Euglena gracilis GN=RBCS1 PE=2 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 3.861e-19
Identity = 38/66 (57.58%), Postives = 52/66 (78.79%), Query Frame = -3
Query:  130 SSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 327
            ++ GYYD RYWTMWKLPM+GCTDA+QVL+E+ E ++ YP  +VR+  FD+ +QVQ ISF+  +P G
Sbjct:  197 TAAGYYDNRYWTMWKLPMFGCTDASQVLREISECRRAYPQCYVRLAAFDSVKQVQVISFVVQRPSG 262          

HSP 2 Score: 95.1301 bits (235), Expect = 3.861e-19
Identity = 38/66 (57.58%), Postives = 52/66 (78.79%), Query Frame = -3
Query:  130 SSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 327
            ++ GYYD RYWTMWKLPM+GCTDA+QVL+E+ E ++ YP  +VR+  FD+ +QVQ ISF+  +P G
Sbjct:  341 TAAGYYDNRYWTMWKLPMFGCTDASQVLREISECRRAYPQCYVRLAAFDSVKQVQVISFVVQRPSG 406          

HSP 3 Score: 95.1301 bits (235), Expect = 3.861e-19
Identity = 38/66 (57.58%), Postives = 52/66 (78.79%), Query Frame = -3
Query:  130 SSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 327
            ++ GYYD RYWTMWKLPM+GCTDA+QVL+E+ E ++ YP  +VR+  FD+ +QVQ ISF+  +P G
Sbjct:  628 TAAGYYDNRYWTMWKLPMFGCTDASQVLREISECRRAYPQCYVRLAAFDSVKQVQVISFVVQRPSG 693          

HSP 4 Score: 95.1301 bits (235), Expect = 3.861e-19
Identity = 38/66 (57.58%), Postives = 52/66 (78.79%), Query Frame = -3
Query:  130 SSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 327
            ++ GYYD RYWTMWKLPM+GCTDA+QVL+E+ E ++ YP  +VR+  FD+ +QVQ ISF+  +P G
Sbjct:  771 TAAGYYDNRYWTMWKLPMFGCTDASQVLREISECRRAYPQCYVRLAAFDSVKQVQVISFVVQRPSG 836          

HSP 5 Score: 95.1301 bits (235), Expect = 3.861e-19
Identity = 38/66 (57.58%), Postives = 52/66 (78.79%), Query Frame = -3
Query:  130 SSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 327
            ++ GYYD RYWTMWKLPM+GCTDA+QVL+E+ E ++ YP  +VR+  FD+ +QVQ ISF+  +P G
Sbjct: 1059 TAAGYYDNRYWTMWKLPMFGCTDASQVLREISECRRAYPQCYVRLAAFDSVKQVQVISFVVQRPSG 1124          

HSP 6 Score: 93.2041 bits (230), Expect = 1.467e-18
Identity = 37/66 (56.06%), Postives = 51/66 (77.27%), Query Frame = -3
Query:  130 SSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 327
            ++ GYYD  YWTMWKLPM+GCTDA+QVL+E+ E ++ YP  +VR+  FD+ +QVQ ISF+  +P G
Sbjct:  484 TAAGYYDNHYWTMWKLPMFGCTDASQVLREISECRRAYPQCYVRLAAFDSVKQVQVISFVVQRPSG 549          

HSP 7 Score: 93.2041 bits (230), Expect = 1.467e-18
Identity = 37/64 (57.81%), Postives = 51/64 (79.69%), Query Frame = -3
Query:  136 SSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKP 327
            ++ GYYD RYWTMWKLPM+GCTDA+QVL+E+ E ++ YP  +VR+  FD+ +QVQ ISF+  +P
Sbjct: 1203 TAAGYYDNRYWTMWKLPMFGCTDASQVLREISECRRAYPQCYVRLAAFDSVKQVQVISFVVQRP 1266          

HSP 8 Score: 90.8929 bits (224), Expect = 7.281e-18
Identity = 38/66 (57.58%), Postives = 52/66 (78.79%), Query Frame = -3
Query:  130 SSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 327
            ++ GYYD RYWTMWKLPM+GCTDA+QVL+E+ E ++ YP  +VR + FD+ +QVQ ISF+  +P G
Sbjct:  916 TAAGYYDNRYWTMWKLPMFGCTDASQVLREISECRRAYPQCYVR-LAFDSVKQVQVISFVVQRPSG 980          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS_CHLMO (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Chlamydomonas moewusii GN=RBCS PE=2 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 8.601e-19
Identity = 37/63 (58.73%), Postives = 49/63 (77.78%), Query Frame = -3
Query:  136 SPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKP 324
            S GYYD RYWTMWKLPM+GCTD +QVL+EV   Q  +P+ ++R++ FDN +QVQC+ FL  +P
Sbjct:   92 SAGYYDNRYWTMWKLPMFGCTDPSQVLREVSACQVAFPNVYIRLVAFDNVKQVQCMGFLVQRP 154          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS2_CHLRE (Ribulose bisphosphate carboxylase small chain 2, chloroplastic OS=Chlamydomonas reinhardtii GN=RBCS-2 PE=1 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 6.815e-16
Identity = 33/60 (55.00%), Postives = 45/60 (75.00%), Query Frame = -3
Query:  136 YYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKP 315
            YYD RYWTMWKLPM+GC D  QVL+E+    K +P ++VR++ FDN++QVQ + FL  +P
Sbjct:  112 YYDNRYWTMWKLPMFGCRDPMQVLREIVACTKAFPDAYVRLVAFDNQKQVQIMGFLVQRP 171          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS1_CHLRE (Ribulose bisphosphate carboxylase small chain 1, chloroplastic OS=Chlamydomonas reinhardtii GN=RBCS-1 PE=1 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 6.815e-16
Identity = 33/60 (55.00%), Postives = 45/60 (75.00%), Query Frame = -3
Query:  136 YYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKP 315
            YYD RYWTMWKLPM+GC D  QVL+E+    K +P ++VR++ FDN++QVQ + FL  +P
Sbjct:  112 YYDNRYWTMWKLPMFGCRDPMQVLREIVACTKAFPDAYVRLVAFDNQKQVQIMGFLVQRP 171          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS3_ACEAT (Ribulose bisphosphate carboxylase small chain 3, chloroplastic OS=Acetabularia acetabulum GN=RBCS-3 PE=2 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.518e-15
Identity = 34/61 (55.74%), Postives = 44/61 (72.13%), Query Frame = -3
Query:  133 YYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPP 315
            Y D RYWTMWKLPM+GCTDA+QVL E+    K +P +++R++ FD  RQVQ   FL  +PP
Sbjct:  109 YQDNRYWTMWKLPMFGCTDASQVLSEIQACTKAFPDAYIRLVCFDANRQVQISGFLVHRPP 169          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS3_ACECL (Ribulose bisphosphate carboxylase small chain 3, chloroplastic OS=Acetabularia cliftonii GN=RBCS-3 PE=2 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 3.382e-15
Identity = 34/64 (53.12%), Postives = 44/64 (68.75%), Query Frame = -3
Query:  133 SPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPP 324
            S  Y D RYWTMWKLPM+GCTD +QVL E+    K +P +++R++ FD  RQVQ   FL  +PP
Sbjct:  107 SSTYQDNRYWTMWKLPMFGCTDGSQVLSEIQACTKAFPDAYIRLVCFDANRQVQISGFLVHRPP 170          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS2_ACECL (Ribulose bisphosphate carboxylase small chain 2 (Fragment) OS=Acetabularia cliftonii GN=RBCS-2 PE=3 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 3.382e-15
Identity = 34/64 (53.12%), Postives = 44/64 (68.75%), Query Frame = -3
Query:  133 SPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPP 324
            S  Y D RYWTMWKLPM+GCTD +QVL E+    K +P +++R++ FD  RQVQ   FL  +PP
Sbjct:   10 SSTYQDNRYWTMWKLPMFGCTDGSQVLSEIQACTKAFPDAYIRLVCFDANRQVQISGFLVHRPP 73          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS5_ACECL (Ribulose bisphosphate carboxylase small chain 5, chloroplastic OS=Acetabularia cliftonii GN=RBCS-5 PE=2 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 4.418e-15
Identity = 33/61 (54.10%), Postives = 43/61 (70.49%), Query Frame = -3
Query:  133 YYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPP 315
            Y D RYWTMWKLPM+GCTD +QVL E+    K +P +++R++ FD  RQVQ   FL  +PP
Sbjct:  111 YQDNRYWTMWKLPMFGCTDGSQVLSEIQACTKAFPDAYIRLVCFDANRQVQISGFLVHRPP 171          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS4_ACECL (Ribulose bisphosphate carboxylase small chain 4, chloroplastic OS=Acetabularia cliftonii GN=RBCS-4 PE=2 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 4.418e-15
Identity = 33/61 (54.10%), Postives = 43/61 (70.49%), Query Frame = -3
Query:  133 YYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPP 315
            Y D RYWTMWKLPM+GCTD +QVL E+    K +P +++R++ FD  RQVQ   FL  +PP
Sbjct:  109 YQDNRYWTMWKLPMFGCTDGSQVLSEIQACTKAFPDAYIRLVCFDANRQVQISGFLVHRPP 169          
BLAST of DT214565 vs. ExPASy Swiss-Prot
Match: RBS2_ACEAT (Ribulose bisphosphate carboxylase small chain 2, chloroplastic (Fragment) OS=Acetabularia acetabulum GN=RBCS-2 PE=2 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 4.418e-15
Identity = 33/61 (54.10%), Postives = 43/61 (70.49%), Query Frame = -3
Query:  133 YYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPP 315
            Y D RYWTMWKLPM+GCTD +QVL E+    K +P +++R++ FD  RQVQ   FL  +PP
Sbjct:  100 YQDNRYWTMWKLPMFGCTDGSQVLSEIQACTKAFPDAYIRLVCFDANRQVQISGFLVHRPP 160          
The following BLAST results are available for this feature:
BLAST of DT214565 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 111
Match NameE-valueIdentityDescription
RBS_EUGGR3.861e-1957.58Ribulose bisphosphate carboxylase small chains, ch... [more]
RBS_CHLMO8.601e-1958.73Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS2_CHLRE6.815e-1655.00Ribulose bisphosphate carboxylase small chain 2, c... [more]
RBS1_CHLRE6.815e-1655.00Ribulose bisphosphate carboxylase small chain 1, c... [more]
RBS3_ACEAT1.518e-1555.74Ribulose bisphosphate carboxylase small chain 3, c... [more]
RBS3_ACECL3.382e-1553.13Ribulose bisphosphate carboxylase small chain 3, c... [more]
RBS2_ACECL3.382e-1553.13Ribulose bisphosphate carboxylase small chain 2 (F... [more]
RBS5_ACECL4.418e-1554.10Ribulose bisphosphate carboxylase small chain 5, c... [more]
RBS4_ACECL4.418e-1554.10Ribulose bisphosphate carboxylase small chain 4, c... [more]
RBS2_ACEAT4.418e-1554.10Ribulose bisphosphate carboxylase small chain 2, c... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS10_22B11_b2 Madame Vinous Sweet Orange Multiple Pathogen-Infected cDNA Library UCRCS10-2 Citrus sinensis cDNA clone UCRCS10-22B11-C22-5.d-polyt, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DT214565 ID=DT214565|Name=DT214565|organism=Citrus sinensis|type=EST|length=713bp
ACAGCAGCCTAAGTAAAATTAAACGCAAACCGAACCCCCATTGATCGAAT
GATCATTATGGGGGTTACACATAATAATAATCAACAATATTGCATGGGTG
GTTACACAAATTTAATTGGGAACCTAGACGCCTGGTGGCTTGGCAGCAAG
GAAACTGATGCACTGCACTTGACGCTTGTTGTCAAATCCGATAATTCGGA
CGAATGAATGTGGGTATTCCTTCTGGACCTCCCCAACCTCCTTCAAAACC
TGGGTTGCATCTGTGCACCCATACATGGGCAGCTTCCACATTGTCCAGTA
GCGTCCATCGTAGTATCCTGGTGAGCTGTGGTGCTCACGGTACACCCATC
CTTTCTGCAGTCACGCCACCCAAAAGAAAAAACAAAAAAAAAAAAAAATC
AAATATCACCACCCATTTGCCTGATAAAATCCGCTTAACCCAAAAGCTTA
AATTTTAAGTAAGCAATTGTTAATGCAGGTTTTGATATTGAATGGATATC
TCTGACCAATAAATTCATGACATGTGTAATTTTTCTCCTAAAGCACATAA
ATAAGGTTCCGTCAAAATAATAGTATATATTAAGAGAGACAGAGAGAGAG
AGAGAGAGAGAGAGAAATGACCTCCAACTCAAATTCCAAGCAGGAAATCC
AGCCGGAGCGGAGAAGGTAACTGATTTCCTTGAGCAAAGCTTCATCGGAC
AGTGGCGGGAGGT
back to top